Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 122613 > 

122613-29-0

Basic Information
CAS No.: 122613-29-0
Name: H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
Molecular Structure:
Molecular Structure of 122613-29-0 (H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2)
Formula: C148H221 N35 O50 S2
Molecular Weight: 3354.67
Synonyms: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2
Safety:
WGK Germany 3
PSA: 1422.53000
LogP: 3.50500
  • Display:default sort

    New supplier

  • 122613-29-0

  • Casno:

    122613-29-0

    122613-29-0

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • PKC fragment CAS No.122613-29-0

  • Casno:

    122613-29-0

    PKC fragment CAS No.122613-29-0

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Appearance:solid or liquid Storage:sealed in cool and dry place Package:As customer's requested Application:Pharma Intermediate Transportation:by courier/air/sea Port:Any port in China

    Guangdong Juda Chemical Industrial Co.,Limited is a company specializing in APIs,pharmaceutical intermediates, electronic chemicals, plant extracts,fine chemicals and cosmetics raw

  •  Guangdong Juda Chemical Industrial Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 13510152023(whatsapp)

    Address:Guangzhou chemical city Tianhe District Guangzhou Guangdong China

       Inquiry Now

  • ProteinKinaseC(530-558)

  • Casno:

    122613-29-0

    ProteinKinaseC(530-558)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

    Watson International Ltd is the business department of FCAD Group. FCAD helps clients from different fields to develop their required fine chemicals or formulations. From pharmaceu

  • Watson International Ltd

    United Kingdom  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+44 (0)2036089360-31

    Address:Chanceryhouse,Chancery Lan

       Inquiry Now

  • Protein Kinase C (530-558)

  • Casno:

    122613-29-0

    Protein Kinase C (530-558)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    *High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein

  • Chinapeptides Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-021-50792271

    Address:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202

       Inquiry Now

  • Protein Kinase C (530-558)

  • Casno:

    122613-29-0

    Protein Kinase C (530-558)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates, polypeptide, and natural extract etc。We are capable to supply you with any quantity of the mentioned products with

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  • Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • PKC fragment

  • Casno:

    122613-29-0

    PKC fragment

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the PKC fragment, CAS:122613-29-0 with the most competitive price and the best quality. W

    Finetech Industry Limited is a company in England,which specializing in developing, manufacturing and marketing fine organic compounds and intermediates for the fine chemical and p

  • Finetech Industry Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-87465837

    Address:wuhan

       Inquiry Now

  • 122613-29-0

  • Casno:

    122613-29-0

    122613-29-0

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • PKC fragMent (530-558)

  • Casno:

    122613-29-0

    PKC fragMent (530-558)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Do best quality products, erect the morality model Application:please email us, thanks

    Wuxi Morality Chemical Co., Ltd is specialized in the development and manufacture of industrial additives, bulk chemical intermediates, pharmaceutical raw materials and pesticide

  • Wuxi Morality Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-510-83597286 17768505220

    Address:B/7F, 321th WuYun Rd, Wanda Plaza, Wuxi City, 214174, China

       Inquiry Now

  • PKC fragment (530-558)

  • Casno:

    122613-29-0

    PKC fragment (530-558)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    high purity Application:Drug intermediates Materials intermediates and active molecules

    Novachemistry offers a broad range of specialty chemicals and customized synthesis services to a range of pharmaceutical, agrochemical and biochemical industries. Novachemistry has

  • NovaChemistry

    United Kingdom  |  Contact Details

    Business Type:Trading Company

    Tel:+44 (0)208 191 7890

    Address:Unit11, Ark Business Centre, Gorden Road, Loughborough, United Kingdom

       Inquiry Now

  • Total:14 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 122613-29-0