Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 163648 > 

163648-32-6

Products Categories

Basic Information
CAS No.: 163648-32-6
Name: ADRENOMEDULLIN (11-50) (RAT)
Molecular Structure:
Molecular Structure of 163648-32-6 (ADRENOMEDULLIN (11-50) (RAT))
Formula: C194H304 N58 O59 S4
Molecular Weight: 0
Synonyms: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (DISULFIDE BRIDGE: 4-9);ADRENOMEDULLIN (11-50) (RAT);H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2;H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2 (DISULFIDE BRIDGE: 4-9)
Related products
Hot Products
  • Display:default sort

    New supplier

  • HIGH PURITY-CAS163648-32-6

  • Casno:

    163648-32-6

    HIGH PURITY-CAS163648-32-6

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • ADRENOMEDULLIN (11-50) (RAT)

  • Casno:

    163648-32-6

    ADRENOMEDULLIN (11-50) (RAT)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • 163648-32-6

  • Casno:

    163648-32-6

    163648-32-6

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • Adrenomedullin (1-50), rat

  • Casno:

    163648-32-6

    Adrenomedullin (1-50), rat

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    *High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein

  • Chinapeptides Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-021-50792271

    Address:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202

       Inquiry Now

  • 163648-32-6

  • Casno:

    163648-32-6

    163648-32-6

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • Adrenomedullin (11-50)

  • Casno:

    163648-32-6

    Adrenomedullin (11-50)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    peptide expert with good price, fast delivery and high qualityAppearance:white powder Storage:keep sealed and keep from direct light Package:According to client's requirements Application:cosmetic or pharmaceutical Transportation:According to client'

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be the most professional, efficient,and reliable partner fo

  • Chengdu Youngshe Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-28-62328193

    Address:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China

       Inquiry Now

  • Total:7 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 163648-32-6