863288-34-0

CJC1295 CAS :863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 9.0-99.0

Our advantages: 1. All inquiries will be replied within 12 hours. 2. Dedication to quality, supply & service. 3. Strictly on selecting raw materials. 4. Reasonable & competitive price, fast lead time. 5. Sample is available for your eva

Our company specializes in processing and selling chemical raw materials, chemical th Asia, Europe, America, Africa and other more than 20 countries and regions. ? Companies adheri

CJC1295 (DAC) CAS 863288-34-0

Min.Order: 1 box

FOB Price:  USD $ 90.0-100.0

1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be sent out in 24 ho

Bodybuilding peptide CJC-1295 does not contain DAC CAS NO.863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

Beluga chemical professional supply Bodybuilding peptide CJC-1295 does not contain DAC CAS NO.863288-34-0 1. Beluga Chemical has a professional RESEARCH and development team and strong technical force to ensure technical support and research capab

Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

High purity CJC1295(DAC) CAS 863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 1.0-1.0

Our advantages: 1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be

HEALTHTIDE BIOTECH CO.,LTD is a collection of production and sales of biotechnology companies.Our company mainly sells plant extracts, chemical raw materials,food additives,raw mat

CJC 1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0

Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

CJC1295 manufacturer with low price

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

We can provide GMP validation service that complies with SFDA, FDA, WHO and EU EMPA.Excellent registration team could help us easlily to register our products in different countries.If you and your customer are interested in some products or need C

Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

CJC-1295 Acetate without DAC 863288-34-0

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

High Quality 99% CJC-1295 863288-34-0 GMP manufacturer

Min.Order: 1 Gram

FOB Price:  USD $ 0.1-0.1

1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

Xi'an Xszo Chem Co. Ltd is a wholly-owned subsidiary of the SZO Chem Group. SZO Group is composed of Xi'an Xszo Chem Co. Ltd & Shaanxi SZO Tech Co., Ltd. SZO industry Group have mo

lower price High quality CJC-1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 1.0-1.0

Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceu

Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech bio chemical products enterprises. The company's

Casno:

863288-34-0

MSDS/COA Download

CJC 1295 (2mg/vial) CAS NO.863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 1.0-3.0

Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

Hebei yanxi chemical co. LTD. has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of

CJC1295/cas：863288-34-0/Raw material spot

Min.Order: 25 Kilogram

FOB Price:  USD $ 1.0-2.0

Name：CJC1295 CAS NO: 863288-34-0 Grade:Medical scientific research and export Molecular formula:C152H252N44O42 Molecular weight:3367.89688 Product Quality 12 years of chemical raw materials Mature operation of the industry System stability

Hubei DiBo chemical co., LTD Hubei DiBo Chemical Co., Ltd. was founded in 2009, is located in Hubei Province on both sides of the Yangtze River, one of the ancient cities of Chines

CJC1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.9-1.0

Advantage : LIDE PHARMACEUTICALS LTD. is a mid-small manufacturing-type enterprise, engaged in pharmaceutical intermediates of R&D, custom-made and production, and also involving trading chemicals for export. We have established the R&

LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

Hot Sell Factory Supply Raw Material CAS 863288-34-0 CJC-1295 (Without DAC)

Min.Order: 10 Kilogram

FOB Price:  USD $ 0.0-0.0

Our Advantage: high quality with competitive price High quality standard: BP/USP/EP Enterprise standard All purity customized Fast and safe delivery We have reliable forwarder who can help us deliver our goods more fast and safe. We

Wuhan Han Sheng New Material Technology Co. Ltd is a professional company which specialized in manufacturing and selling chemical raw materials, chemical products, pharmaceutical i

CJC1295 CAS863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 289.0-499.0

1. Product advantages ♦ High purity, all above 98.5%, no impurities after dissolution ♦ We will test each batch to ensure quality ♦ OEM and private brand services designed for free ♦ Various cap colors available ♦ W

Hebei Sankai Chemical Technology Co., Ltd. is a new chemical enterprise integrating the research, manufacturing and supply of chemicals. Located in the beautiful "cattle city" Xing

98% Quality Protein Peptide Hormones 2Mg/vial White Cjc1295 Without Dac CAS 863288-34-0

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0

Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

CJC 1295 863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0

1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized

Shanghai Upbio Tech Co.,Ltd (Former Onchem (China)Co.,Ltd) is a comprehensive manufacturer and an international distribution of chemicals throughout the world, The predecessor of

Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0

We have overseas warehouses in California, New Laredo Mexico, Vancouver Canada, Amsterdam Netherlands, and Melbourne Australia. Overseas warehouses can provide some of the best-selling products. We look forward to the cooperation of local powerful d

Shanghai Terui OP New Material Technology Co., Ltd. is a company dedicated to the research and development, production and sales of organic compounds, pharmaceutical intermediates

Factory supply CJC1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0

CJC1295 CAS: 863288-34-0 Specification Item Specifications Product Name CJC/1295 Appearance White freeze-dried powder Purity 98%min Boiling point 1265.3ºC at 760 mmHg Density

Lonwin industry group limited.is a comprehensive chemical enterprise which mainly integrates development, production, marketing ,import and export business. The company is located

Casno:

863288-34-0

MSDS/COA Download

CJC-1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 80.0-100.0

1. Timely and efficient service to ensure communication with customers 2. Produce products of different specifications and sizes according to your requirements. 3. Quality procedures and standards recognized by SGS. Advanced plant equipment ensures

Hebei Quanhe Biotechnology Co. LTD. is an enterprise specializing in the research and development, production and trade of pharmaceutical intermediates, apis and chemical raw mater

CJC 1295

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

CJC-1295

Min.Order: 1 Gram

FOB Price:  USD $ 55.0-60.0

Service: 1. Any inquiries will be replied within 12 hours. 2. Dedication to quality, supply & service. 3. Strictly on selecting raw materials. 4. OEM/ODM Available. 5. Reasonable & competitiv

Triumph International Development Limilted is engaged in the API, pharmaceutical intermediates research and developmen.Adhering to the "customer first" business philosophy,we suppl

Factory Supply Supplement 99% Purity CJC-1295 cas 863288-34-0

Min.Order: 1 box

FOB Price:  USD $ 20.0-50.0

Note:Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations please leave me a message。 If you couldn't find the product you want in our store, maybe we haven't uploaded the co

Shanghai Chinqesen Biotechnology Co., Ltd. Company slogan:Innovation, cooperation and win-win Company introduction:Shanghai Chinqesen Biotechnology Co., Ltd. is a professional phar

CJC-1295 (Without DAC)

Min.Order: 0 Metric Ton

FOB Price:  USD $ 0.0-0.0

Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det

Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service profession

CAS 863288-34-0 Quality Peptides Factory Price Cjc-1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 8.0-11.0

High Purity CAS 863288-34-0 Quality Peptides Factory Price Cjc-1295 proname: cjc 1295 (2mg/vial) casno: 863288-34-0 molecular formula: c152h252n44o42 appearance: white application: bodybuilding deliverytime: 3-4 days Description:

SaiWanTe (Shanghai) New Material Technology Co.,Ltd , located in shanghai ,China. It is specialized in the R&D, production and sales of chemical raw matereials, cosmetic additives,

CJC-1295 without DAC 863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 66.0-88.0

Company Profile SHENGZHIKAI TECHNOLOGY INDUSTRY CO., LTD is a high-tech enterprise dedicated to the fields of fine chemical products.The scope of products covers pharmaceutical intermediates, plant extracts, chemical reagent, animal p

SHENGZHIKAI TECHNOLOGY INDUSTRY CO., LTD is a high-tech enterprise dedicated to the fields of fine chemical products. The scope of products covers pharmaceutical intermediates, pla

CJC-1295

Min.Order: 10 Gram

FOB Price:  USD $ 100.0-100.0

Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

CJC-1295 (Without DAC)

Min.Order: 100 Gram

FOB Price:  USD $ 100.0-2000.0

We are one of a few suppliers that can offer custom synthesis service of this product We are specialized in custom synthesis, chemical/pharmaceutical/ pesticides outsourcing and contract research. We are committed to prov

SHANGHAI SYSTEAM BIOCHEM CO., LTD. is one of the professional suppliers in Chinese pharmaceutical market and is specialized in custom synthesis, chemical/pharmaceutical/ pesticides

CJC 1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

Pharmaceutical CJC-1295 Powder CAS 863288-34-0

Min.Order: 1 Kilogram

FOB Price:  USD $ 8.2-8.8

1. A strong scientific research team . 2. Stable quality (with a complete scientific research center and testing center to ensure the quality stability of each batch of products). 3. Rich export experience (with practical experience in exporting to m

Hebei Kunsui Technology Co., Ltd. specializes in exporting high quality Pharmaceutical raw materials, medical devices, plant extract, pesticide raw materials and Chemical raw mate

TIANFUCHEM--CJC1295

Min.Order: 1 Metric Ton

FOB Price:  USD $ 20.0-20.0

Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

Our company engages in Electronic chemicals such as OLED，Photoresist chemical，Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

High Quality CJC-1295(Without DAC)

Min.Order: 1 Kilogram

FOB Price:  USD $ 0.0-0.0

Product name: CJC-1295(Without DAC) CAS No.：863288-34-0 Molecule Formula：C159H258N46O45 Molecule Weight：3367.90 Purity: 98.0% Package: 1g/bag Description：White powder Manufacture Standards：Enterprise Standard TESTI

Siwei Development Group Ltd. is a reputed professional enterprise in China dedicated to the Amino Acids production and sales of fine chemical products.Over the years we have been m

CJC1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,

Zibo Dorne chemical technology co., LTD. is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additive

Top Purity CJC1295

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

Our Advantages A. International Top level TechnologyOur company owned biomedicine experts are famous at home and abroad with rich experience in research and development in the field of efficient chiral functional molecules research and development an

Jiangsu Qianyu Molecular Technology Co., LTD. Jiangsu Qianyu Molecular Technology is a high-tech medical and health enterprise,located in a developed transportation city Xuzhou, Ch

CJC1295

Min.Order: 1 Milligram

FOB Price:  USD $ 0.0-0.0

GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

API Peptides MGF Powder Dosage Usage Effect and Benefit

Min.Order: 1 Kilogram

FOB Price:  USD $ 18.0-20.0

factory?direct?saleAppearance:White Powder Storage:Store In Dry, Cool And Ventilated Place Package:25kg/drum, also according to the clients requirement Application:It is widely used as a thickener, emulsifier and stabilizer Transportation:By Sea Or B

Founded in 2008, East Chemsources Limited is a professional manufacturer of supplier in food and beverage, pharmaceuticals, cosmetics and other industries. pharmaceutical field in

CJC-1295

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

1.High Quality: Quality is life. Quality is the most important element for all goods. We have a lab doing research in Wuhan China and produce sarms in bulk quantity. We have 8 years experience making all kinds of sarms. And all our old customers thr

WUHAN WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of nootropics, herbal extract, OLED etc. Wuhan Wonda Pharm & Ch

CJC1295

Min.Order: 1 Kilogram

FOB Price:  USD $ 2.0-2.0

Zhenyu biotech exported this product to many countries and regions at best price. if you are looking for the material's manufacturer or supplier in china, zhenyu biotech is your best choice. pls contact with us freely for getting detailed

Welcome to Taizhou Zhenyu Biotech Co.,LTD , Sister Company of Ningbo Zhenlei Chemical co.,ltd ,is a rapid growing company , We are one of TOP supplier and manufactuer of Human APIs