134500-80-4

Basic information

• Product Name: BETA-AMYLOID (1-43)
• Synonyms: BETA-AMYLOID (1-43);BETA-AMYLOID (1-43) PEPTIDE;BETA-AMYLOID PEPTIDE [1-43], HUMAN;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT;H2N-D-A-E-F-R-H-D-S-G-Y-E-V-H-H-Q-K-L-V-F-F-A-E-D-V-G-S-N-K-G-A-I-I-G-L-M-V-G-G-V-V-I-A-T-OH;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-OH;A-BETA (1-43);AMYLOID BETA-PROTEIN (1-43)
• CAS NO: 134500-80-4
• Molecular Formula: C207H318N56O62S1
• Molecular Weight: 4615.14
• Product Categories: Alzheimers and Neurodegenerative Disease Research;Amyloid beta Protein Fragments;Amyloid β Protein FragmentsNeuropeptides;Neurodegenerative Disease Peptides;β Amyloid Peptides;Amyloid beta-peptide and related;peptide;Neuroscience
• Mol File: 134500-80-4.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Storage Temp.: −20°C
• CAS DataBase Reference: BETA-AMYLOID (1-43)(CAS DataBase Reference)
• NIST Chemistry Reference: BETA-AMYLOID (1-43)(134500-80-4)
• EPA Substance Registry System: BETA-AMYLOID (1-43)(134500-80-4)

Safety Data

• WGK Germany: 3
• Hazardous Substances Data: 134500-80-4(Hazardous Substances Data)

Usage

General Description

Beta-amyloid (1-43) is a peptide fragment that is derived from the amyloid precursor protein and is found in the brains of individuals with Alzheimer's disease. This peptide is known for its ability to form aggregates and plaques in the brain, which are thought to contribute to the neurodegeneration and cognitive decline seen in Alzheimer's patients. Research has shown that beta-amyloid (1-43) may be involved in disrupting neuronal function and communication, leading to the impaired memory and thinking abilities characteristic of the disease. As a result, beta-amyloid (1-43) has been the focus of much study and interest in the field of Alzheimer's research, with the aim of understanding its role in the disease and developing potential therapeutic interventions.