76543-88-9
Post Buying Request-
-
Basic information
- Product Name: Roferon-A
- Synonyms: Roferon-A;IfnAlpha-2A;A.-Ifn;Aids000156;Aids-000156;alpha Ifn;Cdlpqthslonrralillaqmgrispfsclkdrhdfgfpqeefdgnqfqkaqaisvlhemiqqtfnlfstkdssatwdesllekfytelyqqlndleacviqevgveetplmnedsilavrkyfqritlylt;Interferon-.alpha.-consensus
- CAS NO:76543-88-9
- Molecular Formula:
- Molecular Weight: 0
- EINECS: N/A
- Product Categories: N/A
- Mol File: 76543-88-9.mol
- Article Data: 0
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: N/A
- Solubility: N/A
- CAS DataBase Reference: Roferon-A(CAS DataBase Reference)
- NIST Chemistry Reference: Roferon-A(76543-88-9)
- EPA Substance Registry System: Roferon-A(76543-88-9)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 76543-88-9(Hazardous Substances Data)
76543-88-9 Suppliers
Recommended suppliersmore
76543-88-9 Usage
General Description
Roferon-A is a brand name for a medication that contains the active ingredient interferon alfa-2a. This medication is a type of interferon, which is a protein that helps the body's immune system fight against viral infections and cancer cells. Roferon-A is used to treat certain types of cancer, including hairy cell leukemia, chronic myeloid leukemia, and AIDS-related Kaposi's sarcoma. It is also used to treat chronic viral hepatitis B and C. Roferon-A works by helping the immune system to recognize and attack abnormal cells, and it may also have anti-inflammatory and antiviral effects. It is administered by injection and may cause side effects such as flu-like symptoms, fatigue, and mood changes.Check Digit Verification of cas no
The CAS Registry Mumber 76543-88-9 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 7,6,5,4 and 3 respectively; the second part has 2 digits, 8 and 8 respectively.Calculate Digit Verification of CAS Registry Number 76543-88:
(7*7)+(6*6)+(5*5)+(4*4)+(3*3)+(2*8)+(1*8)=159
159 % 10 = 9
So 76543-88-9 is a valid CAS Registry Number.
76543-88-9Upstream product
76543-88-9Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 76543-88-9
Roferon-A
