Welcome to LookChem.com Sign In|Join Free
  • or
HENAN SUNLAKE ENTERPRISE CORPORATION16961-83-4 F6H2Si Hexafluorosilicic acid//file1.lookchem.com/300w/synthetic/2022-01-22-11/a9f69253-170d-41c5-9483-873953166a45.png
qq

Communicate with Supplier:

Ms. summer
Ms. summer: What can I do for you?

16961-83-4 F6H2Si Hexafluorosilicic acid CAS NO.16961-83-4

Min.Order Quantity:
5 Gram
Purity:
98%
Port:
Tianjin Shanghai
Payment Terms:
L/C,D/A,D/P,T/T,MoneyGram,Other

Add to Inquiry Cart

Product Details

Keywords

  • 16961-83-4 F6H2Si Hexafluorosilicic acid
  • 16961-83-4
  • F6H2Si

Quick Details

  • ProName: 16961-83-4 F6H2Si ...
  • CasNo: 16961-83-4
  • Molecular Formula: F6H2Si
  • Appearance: white powder
  • Application: Inorganics;Acids;Electronic Chemicals;...
  • DeliveryTime: 5-7 days after payment
  • PackAge: Woven bag
  • Port: Tianjin Shanghai
  • ProductionCapacity: 1 Kilogram/Day
  • Purity: 98%
  • Storage: Normal temperature
  • Transportation: Ocean shipping Express delivery
  • LimitNum: 5 Gram

Superiority

hexafluorosilicic acid basic information
product name: hexafluorosilicic acid
synonyms: silicofluoric acid;sysmehfrwgkpvgkkrrpvkvypngaedesaeafplef;ser-tyr-ser-met-glu-his-phe-arg-trp-gly-lys-pro-val-gly-lys-lys-arg-arg-pro-val-lys-val-tyr-pro-asn-gly-ala-glu-asp-glu-ser-ala-glu-ala-phe-pro-leu-glu-phe;ser-tyr-ser-met-glu-his-phe-arg-trp-gly-lys-pro-val-gly-lys-lys-arg-arg-pro-val-lys-val-tyr-pro-asn-gly-ala-glu-asp-glu-ser-ala-glu-ala-phe-pro-leu-glu-phe human;hydrogen hexafluorosilicate;hydrofluorosilicic acid;hydrofluosilicic acid;hydrosilicofluoric acid
cas: 16961-83-4
mf: f6h2si
mw: 144.09
einecs: 241-034-8
product categories: inorganics;acids;electronic chemicals;micro/nanoelectronics;peptide;fluoride
mol file: 16961-83-4.mol
hexafluorosilicic acid structure
hexafluorosilicic acid chemical properties
bp 108-109°c
density 1.22 g/ml at 25 °c
refractive index 1.3500
fp 108-109°c
storage temp. −20°c
solubility h2o: 1 mg/ml, clear, colorless
merck 14,4182
stability: stable in aqueous solution.
cas database reference 16961-83-4(cas database reference)
epa substance registry system silicate(2-), hexafluoro-, dihydrogen(16961-83-4)
safety information
hazard codes c
risk statements 34-35-20/21/22
safety statements 26-36/37/39-45-27
ridadr un 1778 8/pg 2
wgk germany 3
rtecs vv8225000
f 8-10
hazard note corrosive
tsca yes
hazardclass 8
packinggroup ii
hazardous substances data 16961-83-4(hazardous substances data)
msds information
provider language
sigmaaldrich english
acros english
alfa english
hexafluorosilicic acid usage and synthesis
chemical properties colourless liquid; often supplied as a colourless solution in water
general description a colorless fuming liquid with a penetrating pungent odor. corrosive to metals and tissue. both the fumes and very short contact with the liquid can cause severe and painful burns. used in water fluoridation, in hardening cement and ceramics, as a wood preservative.
air & water reactions fumes in air. soluble in water with release of heat and corrosive fumes.
reactivity profile hexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. attacks glass and materials containing silica. reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. can initiate polymerization in certain alkenes. reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give h2s and so3), dithionites (so2), and carbonates. can catalyze (increase the rate of) chemical reactions. decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.
health hazard inhalation of vapor produces severe corrosive effect on mucous membrane. ingestion causes severe burns of mouth and stomach. contact with liquid or vapor causes severe burns of eyes and skin.
fire hazard special hazards of combustion products: irritating fumes of hydrogen fluoride may form in fire.

Details

hexafluorosilicic acid basic information
product name: hexafluorosilicic acid
synonyms: silicofluoric acid;sysmehfrwgkpvgkkrrpvkvypngaedesaeafplef;ser-tyr-ser-met-glu-his-phe-arg-trp-gly-lys-pro-val-gly-lys-lys-arg-arg-pro-val-lys-val-tyr-pro-asn-gly-ala-glu-asp-glu-ser-ala-glu-ala-phe-pro-leu-glu-phe;ser-tyr-ser-met-glu-his-phe-arg-trp-gly-lys-pro-val-gly-lys-lys-arg-arg-pro-val-lys-val-tyr-pro-asn-gly-ala-glu-asp-glu-ser-ala-glu-ala-phe-pro-leu-glu-phe human;hydrogen hexafluorosilicate;hydrofluorosilicic acid;hydrofluosilicic acid;hydrosilicofluoric acid
cas: 16961-83-4
mf: f6h2si
mw: 144.09
einecs: 241-034-8
product categories: inorganics;acids;electronic chemicals;micro/nanoelectronics;peptide;fluoride
mol file: 16961-83-4.mol
hexafluorosilicic acid structure
hexafluorosilicic acid chemical properties
bp 108-109°c
density 1.22 g/ml at 25 °c
refractive index 1.3500
fp 108-109°c
storage temp. −20°c
solubility h2o: 1 mg/ml, clear, colorless
merck 14,4182
stability: stable in aqueous solution.
cas database reference 16961-83-4(cas database reference)
epa substance registry system silicate(2-), hexafluoro-, dihydrogen(16961-83-4)
safety information
hazard codes c
risk statements 34-35-20/21/22
safety statements 26-36/37/39-45-27
ridadr un 1778 8/pg 2
wgk germany 3
rtecs vv8225000
f 8-10
hazard note corrosive
tsca yes
hazardclass 8
packinggroup ii
hazardous substances data 16961-83-4(hazardous substances data)
msds information
provider language
sigmaaldrich english
acros english
alfa english
hexafluorosilicic acid usage and synthesis
chemical properties colourless liquid; often supplied as a colourless solution in water
general description a colorless fuming liquid with a penetrating pungent odor. corrosive to metals and tissue. both the fumes and very short contact with the liquid can cause severe and painful burns. used in water fluoridation, in hardening cement and ceramics, as a wood preservative.
air & water reactions fumes in air. soluble in water with release of heat and corrosive fumes.
reactivity profile hexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. attacks glass and materials containing silica. reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. can initiate polymerization in certain alkenes. reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give h2s and so3), dithionites (so2), and carbonates. can catalyze (increase the rate of) chemical reactions. decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.
health hazard inhalation of vapor produces severe corrosive effect on mucous membrane. ingestion causes severe burns of mouth and stomach. contact with liquid or vapor causes severe burns of eyes and skin.
fire hazard special hazards of combustion products: irritating fumes of hydrogen fluoride may form in fire.

hennan sunlake enterprise corporation is located in henan province , the central plain of china , which enjoys favorable geogeaphical position and convenient transportion, the com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .
sunlake is a professional manufacturer engaged in producing and selling chemicals,including organic & inorganic chemicals , pigments & dyestuffs , water treatment chemicals , food & feed additives and others . these products have been being well exported to europe , southeast asia , the middle east , africa , south america and some other countries and areas.
we sincerely welcome foreign friends to visit our plant for cooperation. with the idea of "quality first,credit priority, excellent service", we are highly acknowledged by customers for good quality and competitive price. more importantly , the company has a strong r & d team, who are professional engineers and scholars with ph. d. .so we are confident to serve you better with our high - quality products and professional team.
we are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market.
we welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

Related Products

Related Keywords

Inquiry Cart 0