USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
our advantages:
1.product capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.
2. samples free trial: our company welcome samples to test our quality then make regular orders.
3. good service: the company have 24 hours online service and feedback to our clients ontime
4. quality guarantee: we have strict quality control system before our delivery and refunds or re-deliver if any quality problems.
5. fast delivery and safe shipping: the compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.
name:exenatide acetate, exenatida
cas no:141732-76-5
formula: c186h286n50o62s
molecular:4246.62
sequence: hgegtftsdlskqmeeeavrlfiewlknggpssgappps
purity:98%
appearance: white powder
source: synthetic
also know as ac 2993, bydureon, byetta, exenatide synthetic, synthetic exendin-4