Welcome to LookChem.com Sign In|Join Free

CAS

  • or
Calcitonin, also known as thyrocalcitonin, is a 32-amino-acid polypeptide hormone secreted by parafollicular cells of the thyroid glands in response to hypocalcemia. It is essential for maintaining calcium homeostasis and has a molecular weight of approximately 3600. The entire 32-residue peptide is required for activity, and common structural features include a COOH-terminal prolinamide, a disulfide bond between residues 1 and 7 at the NH2 terminus, and a chain length of 32 residues.

9007-12-9 Suppliers

Post Buying Request

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier
  • 9007-12-9 Structure
  • Basic information

    1. Product Name: Calcitonin
    2. Synonyms: calcimar(salmon);calcitar;calcitrin;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CALCITONIN (SALMON I)
    3. CAS NO:9007-12-9
    4. Molecular Formula: C145H240N44O48S2
    5. Molecular Weight: 3431.85
    6. EINECS: 256-342-8
    7. Product Categories: N/A
    8. Mol File: 9007-12-9.mol
  • Chemical Properties

    1. Melting Point: N/A
    2. Boiling Point: N/A
    3. Flash Point: N/A
    4. Appearance: /powder
    5. Density: N/A
    6. Refractive Index: N/A
    7. Storage Temp.: −20°C
    8. Solubility: 0.05 M acetic acid: 1 mg/mL, clear, colorless
    9. CAS DataBase Reference: Calcitonin(CAS DataBase Reference)
    10. NIST Chemistry Reference: Calcitonin(9007-12-9)
    11. EPA Substance Registry System: Calcitonin(9007-12-9)
  • Safety Data

    1. Hazard Codes: N/A
    2. Statements: N/A
    3. Safety Statements: 22-24/25
    4. WGK Germany: 3
    5. RTECS: EV8000000
    6. F: 3-10
    7. HazardClass: N/A
    8. PackingGroup: N/A
    9. Hazardous Substances Data: 9007-12-9(Hazardous Substances Data)

9007-12-9 Usage

Uses

Used in Bone Disorders:
Calcitonin is used as a therapeutic agent for the treatment of postmenopausal osteoporosis, hypercalcemia of malignancy, and Paget's disease of the bone. It inhibits calcium resorption from bone, causing hypocalemia, and negates the osteolytic effects of parathyroid hormone.
Used in Hypercalcemia:
Calcitonin is used as a treatment for hypercalcemia, a condition characterized by abnormally high levels of calcium in the blood. It helps to lower calcium levels by inhibiting calcium resorption from bone and increasing calcium excretion in the urine.
Used in Salmon Calcitonin:
Salmon calcitonin is the preferred source of calcitonin due to its greater receptor affinity and longer half-life than the human hormone. It is used as a more effective and longer-lasting treatment option for various bone disorders and hypercalcemia conditions.
Used in Agonists and Antagonists:
Calcitonin and its related peptide hormones, such as CGRP and AMY, have agonist activity, while salmon CT8–32 and AC512 have antagonist activity. These agents can be used to modulate the effects of calcitonin in various therapeutic applications.

Gene structure and mRNA

The human CT gene, located on chromosome 11p15.2- p15.1, consists of six exons and five introns. CT mRNA is coencoded with calcitonin gene-related peptide (CGRP) mRNA in the single gene. In mammals, the synthesis of the mRNAs encoding these two hormones is controlled by tissue-specific alternative splicing. The CT precursor mRNA is synthesized in thyroidal C-cells, whereas the CGRP precursor mRNA is synthesized in neural tissues. The pufferfish ct gene consists of four coding exons. The splicing of exons 1, 2, and 3 yields CT, whereas that of exons 1, 2, and 4 yields CGRP.

Synthesis and release

CT synthesis in thyroid C-cells and its release are stimulated principally by increased blood calcium levels. In fish as well as mammals, a calcium-sensing receptor has been cloned. In fasted eels, plasma CT levels were not detectable by the specific sandwich ELISA technique (detection limit: 30 pg/mL). In eels that were fed a high amount of calcium-consomme solution (Ca2+: 1.25M; 1mL/100 g body weight), the plasma CT concentration increased rapidly (CT: below detection level at 0 h to 1118.2 pg/mL at 3 h) corresponding to increased plasma calcium levels. In fish as well as mammals, the trigger for CT secretion appears to be primarily a change in blood calcium levels. Recently, CT was synthesized in the osteoblasts of goldfish scales. The secretion of CT was promoted by melatonin. This regulation was also observed in the calvariae of rats.

Receptors

The calcitonin receptor (CTR) is a member of a subfamily of the seven-transmembrane domain GPCR superfamily that includes several peptide receptors. Porcine CTR cDNA was obtained for the first time in 1991. Subsequent cloning of the gene demonstrated that it is approximately 70 kb in length, and contains at least 14 exons, 12 of which encode procine CTR. Different isoforms of CTR resulting from alternative splicing of the gene have been described in various animal species with differential tissue expression of the transcripts. The human CTR gene has been mapped to chromosome 7q21.3. CTRs have been identified from various vertebrates. Invertebrate CTR has also been sequenced from the protochordate, Ciona intestinalis. Invertebrate CTs and CTR are described in another section. The value of the dissociation constant (Kd) in rats and trout CTR was 0.25 to 3.3 nM.

Application in Particular Diseases

In Osteoporosis: Calcitonin is released from the thyroid gland when serum calcium is elevated. Salmon calcitonin is used clinically because it is more potent and longer lasting than the mammalian form. Calcitonin is reserved as a third-line agent because efficacy is less robust than with the other antiresorptive therapies. Calcitonin is indicated for osteoporosis treatment for women at least 5 years past menopause. Although limited data suggest beneficial effects in men and concomitantly with glucocorticoids, these indications are not FDA approved. Only vertebral fractures have been documented to decrease with intranasal calcitonin therapy. Calcitonin does not consistently affect hip BMD and does not decrease hip fracture risk. Calcitonin may provide pain relief to some patients with acute vertebral fractures. If used, it should be prescribed for short-term treatment (4 weeks) and should not be used in place of other more effective and less expensive analgesics, nor should it preclude the use of more appropriate osteoporosis therapy. The intranasal dose is 200 units daily, alternating nares every other day. Subcutaneous administration of 100 units daily is available but rarely used because of adverse effects and cost.

Originator

Calcitar,Yamanouchi,Japan,1978

Indications

Calcitonin (Miacalcin, Miacalcin Nasal Spray) is a synthetic 32–amino acid polypeptide that is identical to salmon calcitonin. Salmon calcitonin is more potent than human calcitonin because of its higher affinity for the human calcitonin receptor and its slower metabolic clearance. Administration is by subcutaneous or intramuscular injection or by nasal spray. The absorption of the nasal form is slower than that of the parenteral routes.

Indications

Calcitonin release is normally stimulated by rising serum calcium levels and suppressed by hypocalcemia. The major physiological effects of calcitonin are inhibition of bone resorption and deposition of postabsorptive calcium into bone following a meal, which prevents postprandial hypercalcemia.

Manufacturing Process

The process for the manufacture of human calcitonin in pure form from C-cell rich medulla carcinoma of the thyroid gland or from C-cell metastasis material is one wherein medullar carcinoma of the thyroid gland or C-cell metastasis material, which has been defatted, for example with acetone or ether, and which may have been first purified with alcohol or with aqueous trichloroacetic acid, is extracted one or more times with a solvent system containing water and an alkanol having at most 5 carbon atoms, at a pH of from about 1 to 6, and the extracted product subjected to gel chromatography using aqueous formic acid as eluant. The calcitonin may be separated into its constituents by countercurrent distribution, for example by Craig distribution using a solvent system advantageously containing n-butanol and acetic acid.

Biosynthesis

The regulation of calcitonin synthesis and release from the parafollicular C cells of the thyroid gland is calcium dependent. Rising serum calcium is the principal stimulus responsible for calcitonin synthesis and release. Other hormones, such as glucagon, gastrin, and serotonin, also stimulate calcitonin release. Calcitonin has been isolated in tissues other than the parafollicular C cells (parathyroid, pancreas, thymus, adrenal), but it is not known whether this material is biologically active. Secretagogues, such as gastrin and pancreozymin, may contribute significantly to the regulation of endogenous calcitonin. In fact, it has been postulated that gastrin-induced calcitonin release following meals may help regulate the postprandial calcium deposition in bone. A calcitonin precursor has been identified within the thyroid parafollicular C cells. It is thought to function in a manner analogous to that of proPTH to facilitate intracellular transport and secretion of the hormone. The metabolic degradation of calcitonin appears to occur in both the liver and kidney. Although blood calcitonin levels are normally low, excessive levels have been found in association with medullary carcinoma of the thyroid and more rarely carcinoid tumors of the bronchus and stomach. Serum calcitonin levels are used to screen and monitor patients who have or are suspected of having medullary carcinoma of the thyroid.

Biological Functions

In addition to its antiresorptive action via suppression of osteoclast activity, calcitonin-salmon exhibits a potent analgesic effect and has provided considerable relief to those patients suffering from the pain associated with Paget's disease and osteoporosis. This analgesic effect is a result of calcitonin-stimulated endogenous opioid release. The potency of this analgesic effect has been demonstrated to be 30- to 50-fold that of morphine in selected patients. Calcitonin is preferred over estrogen and the bisphosphonates when treatment of both osteoporosis and related bone pain is warranted.

Acquired resistance

Resistance to calcitonin-salmon can result from the development of neutralizing antibodies.

Mechanism of action

Calcitonin interacts with specific plasma membrane receptors within target organs to initiate biological effects. This interaction has been directly linked to the generation of cAMP via adenylyl cyclase activation.

Pharmacokinetics

Calcitonin-salmon differs structurally from human calcitonin at 16 of 32 amino acids. The pharmacological activity of these calcitonins is the same, but calcitonin-salmon is approximately 50-fold more potent on a weight basis than human calcitonin with a longer duration of action. The duration of action for calcitonin salmon is 8 to 24 hours following intramuscular (IM) or subcutaneous (SC) administration and 0.5 to 12.0 hours following IV administration. The parenteral dose required for the treatment of osteoporosis is 100 IU/day. Initially only available by IM or SC injection, the peptide hormone calcitonin-salmon is available as a nasal spray (Miacalcin) and as a rectal suppository. A recombinant DNA form of calcitonin salmon was approved by the U.S. FDA in 2005 and is available as a nasal spray. The bioavailability of calcitonin-salmon nasal spray shows great variability (range, 0.3–30.6% of an IM dose). It is absorbed rapidly from the nasal mucosa, with peak plasma concentrations appearing 30 to 40 minutes after nasal administration, compared with 16 to 25 minutes following parental dosing. Calcitonin-salmon is readily metabolized in the kidney, with an elimination half-life calculated at 43 minutes. As a result, the intranasal dose required is 200 IU/day. Once the Miacalcin nasal pump has been activated, the bottle may be kept at room temperature until the medication is finished (2 weeks)

Clinical Use

Calcitonin therapy requires the concomitant oral administration of elemental calcium (500 mg/day). Clinical studies have shown that the combination of intranasal calcitonin salmon (200 IU/day), oral calcium supplementation (>1,000 mg/day of elemental calcium), and vitamin D (400 IU/day) has decreased the rate of new fractures by more than 75% and has improved vertebral BMD by as much as 3% annually. Calcitonin prevents the abnormal bone turnover characteristic of Paget's disease of the bone and has antiresorptive activity. In the presence of calcitonin, the osteoclast brush borders disappear, and the osteoclasts move away from the bone surface undergoing remodeling. Side effects are significantly more pronounced when calcitonin-salmon is administered by injection and can include nausea, vomiting, anorexia, and flushing. Because calcitonin-salmon is protein in nature, the possibility of a systemic allergic reaction should be considered,and appropriate measures for treatment of hypersensitivity reaction should be readily available. Although calcitonin-salmon does not cross the placenta, it may pass into breast milk. Calcitonin-salmon is a possible alternative to ERT; however, only limited evidence suggests that it has efficacy in women who already have fractures.

Check Digit Verification of cas no

The CAS Registry Mumber 9007-12-9 includes 7 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 4 digits, 9,0,0 and 7 respectively; the second part has 2 digits, 1 and 2 respectively.
Calculate Digit Verification of CAS Registry Number 9007-12:
(6*9)+(5*0)+(4*0)+(3*7)+(2*1)+(1*2)=79
79 % 10 = 9
So 9007-12-9 is a valid CAS Registry Number.

9007-12-9SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 12, 2017

Revision Date: Aug 12, 2017

1.Identification

1.1 GHS Product identifier

Product name Calcitonin

1.2 Other means of identification

Product number -
Other names -

1.3 Recommended use of the chemical and restrictions on use

Identified uses For industry use only.
Uses advised against no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number -
Service hours Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:9007-12-9 SDS

9007-12-9Upstream product

9007-12-9Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 9007-12-9