Basic Information | Post buying leads | Suppliers |
Name |
CRF (human and rat) |
EINECS | N/A |
CAS No. | 86784-80-7 | Density | N/A |
PSA | 2049.59000 | LogP | 5.89730 |
Solubility | N/A | Melting Point |
N/A |
Formula | C208H344N60O63S2 | Boiling Point | N/A |
Molecular Weight | 4757.45 | Flash Point | N/A |
Transport Information | N/A | Appearance | N/A |
Safety | Risk Codes | N/A | |
Molecular Structure | Hazard Symbols | N/A | |
Synonyms |
Corticotropin-releasingfactor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine-25-L-glutamicacid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-;Corticobiss;Corticotropin-releasing factor (Mesocricetusauratus);Corticotropin-releasingfactor (human);Human ACTH-releasing factor;Human CRF(1-41);Humancorticorelin;Human corticotropin-releasing factor;Human corticotropin-releasing hormone-41;Human/rat CRF;L-Isoleucinamide, L-seryl-L-a-glutamyl-L-a-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-a-aspartyl-L-leucyl-L-threonyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-a-glutamyl-L-valyl-L-leucyl-L-a-glutamyl-L-methionyl-L-alanyl-L-arginyl-L-alanyl-L-a-glutamyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-histidyl-L-seryl-L-asparaginyl-L-arginyl-L-lysyl-L-leucyl-L-methionyl-L-a-glutamyl-L-isoleucyl-;MCI 028;Rat ACTH-releasing hormone;Rat CRF;Rat CRF(1-41);Rat CRF-41;Ratcorticotropin-releasing factor;Rat corticotropin-releasing factor-41;Rathypothalamic CRF;Rat/human CRF;Rat/human corticotropin-releasing factor;Xerecept;rCRF-41;Corticotropin Releasing Factor, human, rat; |
Chemical Name: CRF (HUMAN, RAT)
CAS No.: 86784-80-7
RTECS: GM7925000
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45 g/mol
Storage temp.: -20°C
Product Categories about Human corticotropin-releasing factor (CAS No.:86784-80-7) are Peptide ; CRF receptor and related
The chemical synonymous of Human corticotropin-releasing factor (CAS No.:86784-80-7) are SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 ; SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; Corticotropin releasing factor ; Corticotropin releasing factor (CRF), human, rat ; Corticotropin releasing factor, human ; Corticotropin releasing factor, human and rat ; Corticotropin releasing factor human, rat ; CRF, human and rat
1. | ivn-rat LD50:>1 mg/kg | YACHDS Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241. | ||
2. | ivn-dog LD50:>1 mg/kg | YACHDS Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241. |
Moderately toxic by intravenous route. Experimental reproductive effects. When heated to decomposition it emits toxic vapors of NOx and SOx.