Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products >  > 

CRF (human and rat)

Related Products

Hot Products

Basic Information Post buying leads Suppliers
Name

CRF (human and rat)

EINECS N/A
CAS No. 86784-80-7 Density N/A
PSA 2049.59000 LogP 5.89730
Solubility N/A Melting Point N/A
Formula C208H344N60O63S2 Boiling Point N/A
Molecular Weight 4757.45 Flash Point N/A
Transport Information N/A Appearance N/A
Safety Risk Codes N/A
Molecular Structure Molecular Structure of 86784-80-7 (CRF (HUMAN, RAT)) Hazard Symbols N/A
Synonyms

Corticotropin-releasingfactor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine-25-L-glutamicacid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-;Corticobiss;Corticotropin-releasing factor (Mesocricetusauratus);Corticotropin-releasingfactor (human);Human ACTH-releasing factor;Human CRF(1-41);Humancorticorelin;Human corticotropin-releasing factor;Human corticotropin-releasing hormone-41;Human/rat CRF;L-Isoleucinamide, L-seryl-L-a-glutamyl-L-a-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-a-aspartyl-L-leucyl-L-threonyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-a-glutamyl-L-valyl-L-leucyl-L-a-glutamyl-L-methionyl-L-alanyl-L-arginyl-L-alanyl-L-a-glutamyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-histidyl-L-seryl-L-asparaginyl-L-arginyl-L-lysyl-L-leucyl-L-methionyl-L-a-glutamyl-L-isoleucyl-;MCI 028;Rat ACTH-releasing hormone;Rat CRF;Rat CRF(1-41);Rat CRF-41;Ratcorticotropin-releasing factor;Rat corticotropin-releasing factor-41;Rathypothalamic CRF;Rat/human CRF;Rat/human corticotropin-releasing factor;Xerecept;rCRF-41;Corticotropin Releasing Factor, human, rat;

 

CRF (human and rat) Chemical Properties

Chemical Name: CRF (HUMAN, RAT)
CAS No.: 86784-80-7
RTECS: GM7925000
Molecular Formula: C208H344N60O63S2
Molecular Weight: 4757.45 g/mol
Storage temp.: -20°C
Product Categories about Human corticotropin-releasing factor (CAS No.:86784-80-7) are Peptide ; CRF receptor and related
The chemical synonymous of Human corticotropin-releasing factor (CAS No.:86784-80-7) are SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2 ; SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; Corticotropin releasing factor ; Corticotropin releasing factor (CRF), human, rat ; Corticotropin releasing factor, human ; Corticotropin releasing factor, human and rat ; Corticotropin releasing factor human, rat ; CRF, human and rat

CRF (human and rat) Toxicity Data With Reference

1.    

ivn-rat LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.
2.    

ivn-dog LD50:>1 mg/kg

    YACHDS    Yakuri to Chiryo. Pharmacology and Therapeutics. 20 (Suppl 5),(1992),S1241.

CRF (human and rat) Safety Profile

Moderately toxic by intravenous route. Experimental reproductive effects. When heated to decomposition it emits toxic vapors of NOx and SOx.

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 86784-80-7