Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 213779 > 

213779-13-6

Basic Information
CAS No.: 213779-13-6
Name: Neuropeptide Y (human),N-[5-[(3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]-(9CI)
Molecular Structure:
Molecular Structure of 213779-13-6 (Neuropeptide Y (human),N-[5-[(3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]-(9CI))
Formula: C199H299 N57 O59 S2
Molecular Weight: 0
Synonyms: BIOTIN-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;BIOTINYL-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;BIOTIN-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT);BIOTINYL-NPY (HUMAN, RAT);NEUROPEPTIDE Y, BIOTINYLATED, HUMAN
EINECS:
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance:
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
  • Display:default sort

    New supplier

  • Biotin-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotin-Neuropeptide Y (human, rat)

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Superiority: Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including I

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • Biotinyl-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotinyl-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Angene supplies the compounds with the most competitive price and the best quality; specializes in custom synthesis & building blocks. Welcome the enquiries & orders around the world. Application:chemical research

    Angene is pledged to providing quality chemicals for use in research and development and commercial manufacturing. Angenes offers over 100,000 products including lab reagents, inte

  •  Angene International Limited

    United Kingdom  |  Contact Details

    Business Type:Trading Company

    Tel:+852 8191 6999

    Address:CHURCHILL HOUSE 142-146 OLD STREET

       Inquiry Now

  • Biotin-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotin-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Biotin-Neuropeptide Y (human, rat) Application:Medicine

    Henan Bizhi Chemical Tech Co Ltd, facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production an

  •  Henan Bizhi Chemical Tech Co Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel: +86-371-86658258

    Address:University Science Park

       Inquiry Now

  • Biotinyl-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotinyl-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Cool Pharm, a High and New Technology company,is a supplier of fine chemicals, building blocks and pharmaceutical intermediates which located in Chuansha Economic Park in Shanghai, P.R. China. Storage:Store in cool place. Keep container tightly close

    Cool Pharm, a High and New Technology company,is a supplier of fine chemicals, building blocks and pharmaceutical intermediates which located in Ch

  • coolpharm Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 (21) 60455363

    Address:Shanghai China

       Inquiry Now

  • BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

  • Casno:

    213779-13-6

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    more information,pls contact with us!

    The PolyPeptide Laboratories Group is committed to total customer satisfaction. With more than 50 years of experience and facilities in five countries, we offer a world of advantag

  • POLYPEPTIDE

    Germany  |  Contact Details

    Business Type:Trading Company

    Tel:+49 5331 9561 0

    Address:PolyPeptide Laboratories A/S 3400 Hiller?d Denmark

       Inquiry Now

  • BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

  • Casno:

    213779-13-6

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    In the branche "Biotechnology Products & Services" in Dublin, California 2 companies are listed. Synpep Corporation in Dublin is rated as avrg. good. If you are the owner of "Synpe

  • SynPep Corporation

    Germany  |  Contact Details

    Business Type:Trading Company

    Tel:(925) 803-9250

    Address:Dublin, CA 94568

       Inquiry Now

  • Total:7 Page 1 of 1 1

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields