Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 213779 > 

213779-13-6

Products Categories

Basic Information
CAS No.: 213779-13-6
Name: Neuropeptide Y (human),N-[5-[(3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]-(9CI)
Molecular Structure:
Molecular Structure of 213779-13-6 (Neuropeptide Y (human),N-[5-[(3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]-(9CI))
Formula: C199H299 N57 O59 S2
Molecular Weight: 0
Synonyms: BIOTIN-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;BIOTINYL-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;BIOTIN-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT);BIOTINYL-NPY (HUMAN, RAT);NEUROPEPTIDE Y, BIOTINYLATED, HUMAN
EINECS:
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance:
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
  • Display:default sort

    New supplier

  • Biotin-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotin-Neuropeptide Y (human, rat)

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Superiority: Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including I

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • Biotin-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotin-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    We are a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates, polypeptide, and natural extract etc。We are capable to supply you with any quantity of the mentioned products with

    RC supply CO., ltd. is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves fine chemical, API, pharmaceutical intermediates and natural ex

  •  XUMEIXIANG

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:13437110400

    Address:wuhan

       Inquiry Now

  • Biotinyl-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotinyl-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Angene supplies the compounds with the most competitive price and the best quality; specializes in custom synthesis & building blocks. Welcome the enquiries & orders around the world. Application:chemical research

    Angene is pledged to providing quality chemicals for use in research and development and commercial manufacturing. Angenes offers over 100,000 products including lab reagents, inte

  •  Angene International Limited

    United Kingdom  |  Contact Details

    Business Type:Trading Company

    Tel:+852 8191 6999

    Address:CHURCHILL HOUSE 142-146 OLD STREET

       Inquiry Now

  • Biotinyl-Neuropeptide Y (human, rat)

  • Casno:

    213779-13-6

    Biotinyl-Neuropeptide Y (human, rat)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Cool Pharm, a High and New Technology company,is a supplier of fine chemicals, building blocks and pharmaceutical intermediates which located in Chuansha Economic Park in Shanghai, P.R. China. Storage:Store in cool place. Keep container tightly close

    Cool Pharm, a High and New Technology company,is a supplier of fine chemicals, building blocks and pharmaceutical intermediates which located in Ch

  • coolpharm Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 (21) 60455363

    Address:Shanghai China

       Inquiry Now

  • BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

  • Casno:

    213779-13-6

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    more information,pls contact with us!

    The PolyPeptide Laboratories Group is committed to total customer satisfaction. With more than 50 years of experience and facilities in five countries, we offer a world of advantag

  • POLYPEPTIDE

    Germany  |  Contact Details

    Business Type:Trading Company

    Tel:+49 5331 9561 0

    Address:PolyPeptide Laboratories A/S 3400 Hiller?d Denmark

       Inquiry Now

  • BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

  • Casno:

    213779-13-6

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT)

    In the branche "Biotechnology Products & Services" in Dublin, California 2 companies are listed. Synpep Corporation in Dublin is rated as avrg. good. If you are the owner of "Synpe

  • SynPep Corporation

    Germany  |  Contact Details

    Business Type:Trading Company

    Tel:(925) 803-9250

    Address:Dublin, CA 94568

       Inquiry Now

  • Total:8 Page 1 of 1 1

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields