Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 86168 > 

86168-78-7

Basic Information
CAS No.: 86168-78-7
Name: Sermorelin
Molecular Structure:
Molecular Structure of 86168-78-7 (Sermorelin)
Formula: C149H246N44O42S
Molecular Weight: 3357.88
Synonyms: Sermorelin [INN:BAN];Somatoliberin (human pancreatic islet), 29-L-argininamide-30-de-L-glutamine-31-de-L-glutamine-32-deglycine-33-de-L-glutamic acid-34-de-L-serine-35-de-L-asparagine-36-de-L-glutamine-37-de-L-glutamic acid-38-de-L-arginine-39-deglycine-40-de-L-alanine-41-de-L-arginine-42-de-L-alanine-43-de-L-argininyl-44-de-L-leucinamide;Sermorelina;Sermorelina [Spanish];Sermoreline;Sermoreline [French];Sermorelinum;Sermorelinum [Latin];UNII-89243S03TE;
EINECS:
Density: 1.45 g/cm3
Melting Point:
Boiling Point:
Flash Point:
Solubility:
Appearance: White powder
Hazard Symbols:
Risk Codes:
Safety:
Transport Information:
  • Display:default sort

    New supplier

  • Factory sermorelin IN  STOCK CAS 86168-78-7

  • Casno:

    86168-78-7

    Factory sermorelin IN STOCK CAS 86168-78-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Service we can provide: 1. Mixed container, we can mix different items in one container. 2. Quality control, before shipment, free sample for test. after shipment, keep sample for 3 years 3. Prompt shipment with professional documents 4. Packin

    Shaanxi wuzhiyuan biological technology Co., Ltd is committed to the development of import and export trade in the production, operation and plant extracts of pharmaceutical r

  •  Shaanxi WuZhiYuan Biological Technology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86 18791979989

    Address:No24.west fengming road,fengming town,qishan county

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Professional peptide manufacturer in China. High quality with GMP grade large scale with Competitive price Our products include: Generic bulk peptide APIs, Cosmetic peptide, custom peptides and veterinary peptides. Appearance:

    Shenzhen JYMed Technology Co., Ltd is a high-tech enterprise specializing in R&D, manufacture and commercialigation of peptides and related products including: the generic bulk pep

  •  Shenzhen JYMed Technology Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-755-26612112

    Address:RM1-105, Shenzhen Bio-incubator Base, 10 Gaoxin C Avc 1st, Nanshan District, Shenzhen, GD, China, 518057

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including Intermediates &a

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditides and natural extract etc. We are capable to supply you with any quan

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  •  Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • afine-SERMORELIN ACETATE

  • Casno:

    86168-78-7

    afine-SERMORELIN ACETATE

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Our Services 1. New Molecules R&D 2. Own test center HPLC NMR GC LC-MS 3. API and Intermediates from China reputed manufacturers 4. Documents support COA MOA MSDS DMF open part Our advantages 1. Government awarded company. Top 100 enter

    AFINE CHEMICALS LIMITED is specialized in the fine chemicals and pharmaceuticals and we have enjoyed great popularity in world markets. Since 2005, we have been rapidly growing to

  •  Afine Chemicals Limited

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-85134551

    Address:No. 206 Zhen Hua Road, Hangzhou 310030, Zhejiang, China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    cGMP factory with our own researh center and special R&D team,relatively low price compare to others. Product Name: Sermorelin; Superiority: 1. favorable price; 2. superior qulity; 3. being produced under GMP st

    Zhejiang Peptites Biotech Co.,Ltd is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP

  •  Zhejiang Peptites Biotech Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-575-83835818

    Address:No.8,Hengyizhi Road,Sanjie Town,Shengzhou City,Zhejiang,China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-3.0/Kilogram

    Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantities

    Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

  •  Hangzhou Dayangchem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • Sermorelin Acetate Grf 1-29 Hormone CAS NO.86168-78-7

  • Casno:

    86168-78-7

    MSDS/COA Download

    Sermorelin Acetate Grf 1-29 Hormone CAS NO.86168-78-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-3.0/Kilogram

    Reason for Choosing us: 1): Superior Quality and Competitive Price: Our company is a renowned pharmaceutical manufacturer with more than 15 years experiences in China and all powders are supplying from our factory directly. 2): Fast ,Sa

    Hebei yanxi chemical co. LTD. has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of

  •  Hebei yanxi chemical co.,LTD.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-0311-66561638

    Address:Zhang zhe, guangzong county, xingtai city, hebei province

       Inquiry Now

  • Buying good quality SERMORELIN 86168-78-7 for sale

  • Casno:

    86168-78-7

    MSDS/COA Download

    Buying good quality SERMORELIN 86168-78-7 for sale

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Buying good quality SERMORELIN 86168-78-7 for sale Our Competitive Advantage: 1.Best quality in your requirement 2.Competitive price in China market 3.mature Technical support 4.Professional logistic support All we w

    Hangzhou Dingyan Chem Co., LTD. is located in the beautiful tourist city of hangzhou, is a comprehensive chemical enterprice which doing import and export business by its own comp

  •  Hangzhou Dingyan Chem Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-571-86465881,86-571-87157530,86-571-88025800

    Address:RM.1118,NO.1 Building, Baiyun Tower,Jianggan Area, Hangzhou city, China,310004

       Inquiry Now

  • High quality Sermorelin acetate supplier in China

  • Casno:

    86168-78-7

    High quality Sermorelin acetate supplier in China

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    1) High quality with competitive price: We are manufacturer and can provide high quality products with factory price. 2) Fast and safe delivery a) Parcels can be sent out within 1-7days after payment and tracking number is available.

    READLINE was established in 2013. The company is headquartered in the "National Science and Technology Business Incubator" in Shenzhen Nanshan Hi-tech Industrial Park. It is an inn

  •  Shenzhen READLINE Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-755-26659310

    Address:2-101,Bio-incubator, Gaoxin C.1st Ave., Shenzhen Hi-tech Industrial Park,ShenZhen,

       Inquiry Now

  • sermorelin

  • Casno:

    86168-78-7

    sermorelin

    Min.Order: 10 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    1.Professional synthesis laboratory and production base. 2.Strong synthesis team and service team. 3.Professional data management system. 4.We provide the professional test date and product information ,ex. HNMR ,CNMR,FNMR, HPLC/G

    Founded in 2011, Amadis Chemical Company Limited is an innovative manufacturer of chemical products and technical service providers. Our business includes sales, manufacture, and s

  •  Amadis Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-89925085

    Address:Watts Cosine.No.166.Xiangmao Road.

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Chemwill Asia co.,Ltd is one of the leading manufacturer in CHINA.Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Active pharmaceutical ingredients(APIs), Veterinary, Indole derivatives, Aro

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    ISO 9001 Certified We implement ISO management throughout our day to day operation. Since we started ISO system in Year 2008, we improve each year to implement the management system in details of each supplying process. This helps us to provi

    Shanghai Sunwise Chemical Co., Ltd facilitates the deliveries of fine and specialty chemicals from China to global markets. We align suppliers and buyers and then take full respons

  •  Shanghai Sunwise Chemical Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-21-60906580

    Address:Room 2108-2110, South Tower, Fortune 108 Plaza, No 1839, Qixin Road, Shanghai, P. R. China

       Inquiry Now

  • Offer 86168-78-7 C149H246N44O42S  Sermorelin

  • Casno:

    86168-78-7

    Offer 86168-78-7 C149H246N44O42S Sermorelin

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 750.0-850.0/Kilogram

    1. ISO 9001 approved, GMP producing standard,Proffesional QA system, our quality is guaranteed. 2. Facotory direct sale, most comptive price ensured; 3. Audited Supplier on lookchem, No trick, No Scam! 4. Enough stock can make sure safe deliv

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371- 55366292

    Address:No.110 HONGZHUAN ROAD, ZHENGZHOU,HENAN

       Inquiry Now

  • Sermorelin Acetate Grf 1-29 Hormone CAS NO.86168-78-7

  • Casno:

    86168-78-7

    MSDS/COA Download

    Sermorelin Acetate Grf 1-29 Hormone CAS NO.86168-78-7

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1000.0-1500.0/Kilogram

    Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP

    Thanks for your considering of Crovell Biotech (Hebei) Co., Ltd. Crovell is a fast growing intermediates company,Which located in Shijiazhuang,Hebei Province. Crovell is speciali

  •  Crovell Biotech (Hebei) Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+8619930501653

    Address:No.66, Yvhua West Road

       Inquiry Now

  • Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

  • Casno:

    86168-78-7

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Our Adwantage: 1.We have stock so we can delivery quickly at the very day when receive the payment. 2.Best price, first class service, high successful delivery rate. A discount would be given when you make a large order. 3.High quality gua

    Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

  •  Hubei XinRunde Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-27-83214668

    Address:No.43, Xinandu Industrial Park, East and West Lake District, Wuhan, Hubei, China

       Inquiry Now

  • 86168-78-7  Sermorelin

  • Casno:

    86168-78-7

    86168-78-7 Sermorelin

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    Our company was built in 2009 with an ISO certificate.In the past 5 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.O

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Sermorelin 86168-78-7 Sermorelina

  • Casno:

    86168-78-7

    Sermorelin 86168-78-7 Sermorelina

    Min.Order: 10 Gram

    FOB Price:  USD $ 210.0-250.0/Gram

    All of dear customer look here good supplier with Top quality Factory price Our company was founded in March 27, 2007, mainly engaged in chemical products Advantages: 1. Samples are provided for test; 2. Good quali

    Our company( GZ HONCH CHEMICAL TECHNOLOGY CO.,LTD) was founded in March 27, 2007.Our company mainly engaged in chemical products ,our products TOP purity with goodquality and o

  •  GZ HONCH CHEMICAL TECHNOLOGY CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8615322315498

    Address:NO.53,YONGTAI ROAD BAIYU District Guangzhou

       Inquiry Now

  • Professional Yinherb Lab supply Sermorelin peptide with 99% purity

  • Casno:

    86168-78-7

    Professional Yinherb Lab supply Sermorelin peptide with 99% purity

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics, Sarms and Peptides researching and developing, and become the lead

    Xi'an Yinherb Bio-Tech Co., Ltd was founded in 2009, We have more than 10 experienced doctors and scientists and professional managers, specializing in Nootropics,Sarms and Peptide

  •  Xi'an Yinherb Bio-Tech Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-29-63332330

    Address:No.13 Bridge,Kunming Rd, Hi-tech Zone, Xi'an city, China

       Inquiry Now

  • Sermorelin 2mg/vial 5mg/vial 10mg/vial

  • Casno:

    86168-78-7

    Sermorelin 2mg/vial 5mg/vial 10mg/vial

    Min.Order: 20 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    Item Specification Result Appearance White powder Complies Identification Positive

    Changzhou Xuanming Chemical CO, LTD is dedicated to the technology development, manufacturing, import and export chemicals, which are specialized in pharmaceutical intermediates, p

  •  Changzhou Xuanming Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86 0519 85525329

    Address:China Town, Xinbei, Changzhou, Jiangsu Room 6019

       Inquiry Now

  • CAS NO.86168-78-7 Sermorelin

  • Casno:

    86168-78-7

    CAS NO.86168-78-7 Sermorelin

    Min.Order: 1 Gram

    FOB Price:  USD $ 50.0-100.0/Gram

    CAS NO.86168-78-7 Sermorelin Superiority Our advantages: 1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can pr

    Wuhan Monad Medicine Tech Co.,LTD is a research and development, production, sales in one high-tech company, own about 100 kinds of products, can provide about more than 30000 kind

  •  Wuhan Monad Medicine Tech Co.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8613397160123

    Address:13th Floor, Tower B, Century Plaza, Zhongnan Road, Wuchang District, Wuhan, China.

       Inquiry Now

  • Factory High quality Sermorelin(CAS:86168-78-7)

  • Casno:

    86168-78-7

    Factory High quality Sermorelin(CAS:86168-78-7)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Email:heidi@coreychem.com Sermorelin Basic information Product Name: Sermorelin Synonyms: Green tea powdered extract;SERMORELIN, GROWTH HORMONE RELEASING FACT

    Career Henan Chemical Co, based on the original Zhengzhou Cote Chemical Research Institute, be brave in absorbing highly educated talents & overseas returnees; actively responded t

  •  Career Henan Chemical Co

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-371-86658258

    Address:Building 10 of Innovation Park, East District of the National University Science Park

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 10 Gram

    FOB Price:  USD $ 1.0-2.0/Gram

    Price, Service, Company and Transport Advantage: 1.Place of Origin China with Super quality by reasonable price. 2.Fast delivery by safe express way to all the country. 3.Has a number of highly qualified engineers a

    We, Jilin Tely Imp & Exp Co., Ltd. mainly supply and export products including: pharmaceutical raw materials,Chemical reagents, Food additives, pharmaceutical and pesticide interme

  •  Jilin Tely Imp.& Exp.Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-0431-81915458

    Address:Room 302, 47 Changping Street, Chaoyang District, Changchun, Jilin Province,China

       Inquiry Now

  • Sermorelin API CAS NO.86168-78-7 Peptide  manufacturer

  • Casno:

    86168-78-7

    Sermorelin API CAS NO.86168-78-7 Peptide manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    Professional manufacturer in China High quality with GMP grade The most competitive price Prompt shipment Good after- sales service pharmaceutical intermediate packing as per customers' requirements Appearance:white powder Stora

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Changzhou Extraordinary Pharmatech co., LTD. As a leading chemical manufacturer and supplier in China.DAS authentication is passed.We can provide the popular precursor chemicals, we have our own strong R & D team, have our own laboratories and fa

    Changzhou Extraordinary Pharmatech co., LTD. Is a full technical team and for the development of hardware and software facilities manufacturing enterprises,The company is located i

  •  Changzhou Extraordinary Pharmatech co.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 519 82111935

    Address:Chinese Jiangsu Province Changzhou City Jintan District Jincheng Town Miaotou NO4(Pharmaceutical Park)

       Inquiry Now

  • Sermorelin 86168-78-7

  • Casno:

    86168-78-7

    Sermorelin 86168-78-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 55.0-60.0/Gram

    Service: 1. Any inquiries will be replied within 12 hours. 2. Dedication to quality, supply & service. 3. Strictly on selecting raw materials. 4. OEM/ODM Available. 5. Reasonable & competitiv

    Triumph International Development Limilted is engaged in the API, pharmaceutical intermediates research and developmen.Adhering to the "customer first" business philosophy,we suppl

  •  Triumph International Development Limilted

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-536-7971999

    Address:Yinhai Road,Shouguang

       Inquiry Now

  • Top Quality Peptide Powder Sermorelin Acetate 86168-78-7 CAS NO.86168-78-7

  • Casno:

    86168-78-7

    Top Quality Peptide Powder Sermorelin Acetate 86168-78-7 CAS NO.86168-78-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    FAQ 1. Can I get a free sample Yes, but you have to pay the courier fee. 2. How to pay We accept payments in the form of Western Union, MoneyGram, Bitcoin, etc. 3. What should I do if we don’t ship after payment We are a formal c

    In 2009, Dr Zhang Lin from Johns Hopkins University founded the theta Biological Laboratory. He is committed to the study of protein assimilation preparations. In 2013,Dr Zhang Li

  •  Theta biotechnology CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8617109360723

    Address:Xiangxinan Big market Shaoyang Hunan China

       Inquiry Now

  • Sermorelin Acetate

  • Casno:

    86168-78-7

    Sermorelin Acetate

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    High purity Fast delivery In stock always We promise full refund if any quality problems Appearance:White powder Storage:Store at 2-8 degrees Package:Customized packing Application:Active pharmaceutical intermediate Transportation:DHL, F

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be the most professional, efficient,and reliable partner fo

  •  Chengdu Youngshe Chemical Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-28-62328193

    Address:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    1.More than 10 years trading experience in chemicals 2. Long-term cooperation with OEM factories and lab. 3. Professional procurement and quality control team 4. Free Sample 5. Factroy + Trading + Customer S

    WEIFANG LUZE NEW MATERIAL CO., LTD. located in Shouguang industrial park in Shandong Povince. Our company covers an area of 20000 square meters,including production Processing work

  •  Weifang Ruze New Material Co.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:13583611556

    Address:No.307A, Langongyuan,software?park,?Weifang University of Scientific and Technology,Shouguang City, Weifang City,Shandong Province ,China

       Inquiry Now

  • Pharmaceutical Peptide Sermorelin, Sermoreline 2mg

  • Casno:

    86168-78-7

    Pharmaceutical Peptide Sermorelin, Sermoreline 2mg

    Min.Order: 1 Milligram

    FOB Price:  USD $ 1.0-1.0/Milligram

    We promise our customer following items 1.Reasonable price: We provide high quality products with competitive price in china, 2.Low moq: No worry about the low moq, our moq is 1 gram or lower. 3.Good and efficient service,Fast Delivery

    SHANDONG SIGMACHEMICAL is mainly engaged in R&D, manufacturing and marketing pharmaceuticals, chemical intermediates, Biochemicals, Veterinary medicines and Nutrition products. Wit

  •  Qingdao Sigma Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0532-80916960

    Address:shandong qingdao

       Inquiry Now

  • Sermorelin

  • Casno:

    86168-78-7

    Sermorelin

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 100.0-100.0/Kilogram

    HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. HangYu Chemical consis

    Zibo HangYu Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals

  •  Zibo Hangyu Import&Export Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15988566987

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • SERMORELIN

  • Casno:

    86168-78-7

    SERMORELIN

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0/Kilogram

    1, High quality with competitive price: 2, Fast and safe delivery 3.Excellent pre-sales and after-sales service 4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years Appearance:powder Storage:St

    Hangzhou Clap Technology Co., Ltd is a leading manufacturer and supplier of API, Pharma intermediates, organic and inorganic compounds, rare earth, pesticide, raw drugs, fine chemi

  •  HANGZHOU CLAP TECHNOLOGY CO,.LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-1358-8875226

    Address:Room 4198,Floor 4,No.4,ShanXian Road XiaCheng District,HangZhou city,ZheJiang province,China

       Inquiry Now

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields