Welcome to LookChem.com Sign In|Join Free

CAS

  • or

114547-31-8

Post Buying Request

114547-31-8 Suppliers

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier
  • L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-his

    Cas No: 114547-31-8

  • No Data

  • No Data

  • 10000 Metric Ton/Month

  • Henan Wentao Chemical Product Co., Ltd.
  • Contact Supplier
  • L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-his

    Cas No: 114547-31-8

  • No Data

  • No Data

  • No Data

  • Research Peptide Biotechnology Co., Ltd.
  • Contact Supplier

114547-31-8 Usage

General Description

Galantin, rat is a peptide hormone and neurotransmitter that is found in the brains and gastrointestinal systems of mammals, including rats. It is involved in the regulation of various physiological processes such as energy homeostasis, behavior, cognition, and the stress response. Galanin has been implicated in the modulation of pain perception, mood, and anxiety, and has also been shown to play a role in the regulation of food intake and body weight. Additionally, galanin has been suggested to have potential therapeutic implications in the treatment of neurodegenerative disorders, mood disorders, and metabolic diseases. Overall, galanin, rat is a multifunctional molecule with diverse physiological roles in the body.

Check Digit Verification of cas no

The CAS Registry Mumber 114547-31-8 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,1,4,5,4 and 7 respectively; the second part has 2 digits, 3 and 1 respectively.
Calculate Digit Verification of CAS Registry Number 114547-31:
(8*1)+(7*1)+(6*4)+(5*5)+(4*4)+(3*7)+(2*3)+(1*1)=108
108 % 10 = 8
So 114547-31-8 is a valid CAS Registry Number.

114547-31-8SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 18, 2017

Revision Date: Aug 18, 2017

1.Identification

1.1 GHS Product identifier

Product name Galanin (1-29) (rat, mouse)

1.2 Other means of identification

Product number -
Other names GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

1.3 Recommended use of the chemical and restrictions on use

Identified uses For industry use only.
Uses advised against no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number -
Service hours Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:114547-31-8 SDS

114547-31-8Upstream product

114547-31-8Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 114547-31-8