Welcome to LookChem.com Sign In|Join Free

CAS

  • or
Calcitonin, chicken is a polypeptide hormone that originates from the thyroid glands of chickens. It plays a crucial role in regulating calcium levels in the blood by inhibiting bone breakdown and promoting calcium excretion through the kidneys. This hormone has been utilized in the management of osteoporosis and other bone-related disorders, as well as in research focused on calcium regulation and bone metabolism. Additionally, it holds potential for the development of new treatments for bone diseases and serves as a valuable tool for studying the physiological and pathological roles of calcitonin in humans.

100016-62-4

Post Buying Request

100016-62-4 Suppliers

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier

100016-62-4 Usage

Uses

Used in Pharmaceutical Industry:
Calcitonin, chicken is used as a therapeutic agent for the treatment of osteoporosis and other bone-related disorders. It helps in maintaining bone strength and density by inhibiting bone resorption and promoting calcium excretion, thereby reducing the risk of fractures and improving overall bone health.
Used in Research and Development:
Calcitonin, chicken serves as a valuable research tool for studying the physiological and pathological roles of calcitonin in humans. It aids in understanding the mechanisms of calcium regulation and bone metabolism, which can contribute to the development of novel treatments for bone diseases and other related conditions.
Used in Diagnostic Applications:
Calcitonin, chicken can be employed as a diagnostic marker for certain conditions, such as medullary thyroid carcinoma, where elevated levels of calcitonin in the blood can indicate the presence of the disease. This allows for early detection and timely intervention, improving patient outcomes.

Check Digit Verification of cas no

The CAS Registry Mumber 100016-62-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,0,0,0,1 and 6 respectively; the second part has 2 digits, 6 and 2 respectively.
Calculate Digit Verification of CAS Registry Number 100016-62:
(8*1)+(7*0)+(6*0)+(5*0)+(4*1)+(3*6)+(2*6)+(1*2)=44
44 % 10 = 4
So 100016-62-4 is a valid CAS Registry Number.

100016-62-4SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 17, 2017

Revision Date: Aug 17, 2017

1.Identification

1.1 GHS Product identifier

Product name CALCITONIN, CHICKEN

1.2 Other means of identification

Product number -
Other names LSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2

1.3 Recommended use of the chemical and restrictions on use

Identified uses For industry use only.
Uses advised against no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number -
Service hours Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:100016-62-4 SDS

100016-62-4Upstream product

100016-62-4Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 100016-62-4