Welcome to LookChem.com Sign In|Join Free

CAS

  • or

100016-62-4

Post Buying Request

100016-62-4 Suppliers

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier

100016-62-4 Usage

General Description

Calcitonin, chicken is a polypeptide hormone derived from the thyroid glands of chickens. It acts to regulate calcium levels in the blood by inhibiting the breakdown of bone and promoting the excretion of calcium by the kidneys. It has been used in the treatment of osteoporosis and other bone-related disorders, as well as in research related to calcium regulation and bone metabolism. The hormone is also of interest for its potential applications in the development of new treatments for bone diseases and as a tool for studying the physiological and pathological roles of calcitonin in humans.

Check Digit Verification of cas no

The CAS Registry Mumber 100016-62-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,0,0,0,1 and 6 respectively; the second part has 2 digits, 6 and 2 respectively.
Calculate Digit Verification of CAS Registry Number 100016-62:
(8*1)+(7*0)+(6*0)+(5*0)+(4*1)+(3*6)+(2*6)+(1*2)=44
44 % 10 = 4
So 100016-62-4 is a valid CAS Registry Number.

100016-62-4SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 17, 2017

Revision Date: Aug 17, 2017

1.Identification

1.1 GHS Product identifier

Product name CALCITONIN, CHICKEN

1.2 Other means of identification

Product number -
Other names LSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2

1.3 Recommended use of the chemical and restrictions on use

Identified uses For industry use only.
Uses advised against no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number -
Service hours Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:100016-62-4 SDS

100016-62-4Upstream product

100016-62-4Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 100016-62-4