BIG ET-1 (1-38) (HUMAN) is a peptide hormone that is part of the endothelin protein family. It serves as a precursor to the vasoconstrictive peptide endothelin-1, which is crucial for the regulation of blood pressure and vascular tone. The "BIG" in its name signifies its larger molecular size before being processed into the biologically active form. This precursor is cleaved to generate endothelin-1, which then binds to endothelin receptors in vascular smooth muscle cells, causing vasoconstriction. The peptide is synthesized in various tissues, including the endothelium, and is involved in physiological processes such as blood flow regulation and the maintenance of cardiovascular homeostasis. Its dysregulation has been associated with several cardiovascular diseases, highlighting its significance as a target for therapeutic interventions.
121014-53-7
Post Buying Request-
-
Basic information
- Product Name: BIG ET-1 (1-38) (HUMAN)
- Synonyms: ENDOTHELIN, BIG 38;Big endothelin 1(1-38);Cys(1)-Ser-Cys(2)-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys(2)-Val-Tyr-Phe-Cys(1)-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH;Big Endothelin-1 (huMan) Big ET-1 (1-38) (huMan);H-CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG-SER-OH;CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG-SER;CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS;CSCSSLMDKECVYFCHLDIIWVNIPEHWPYGLGSPRS
- CAS NO:121014-53-7
- Molecular Formula: C189H287N49O55S5
- Molecular Weight: 4285.92138
- EINECS: N/A
- Product Categories: Peptide;Cardiovescular;proteins
- Mol File: 121014-53-7.mol
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: BIG ET-1 (1-38) (HUMAN)(CAS DataBase Reference)
- NIST Chemistry Reference: BIG ET-1 (1-38) (HUMAN)(121014-53-7)
- EPA Substance Registry System: BIG ET-1 (1-38) (HUMAN)(121014-53-7)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 121014-53-7(Hazardous Substances Data)
121014-53-7 Suppliers
Recommended suppliers
121014-53-7 Usage
Uses
Used in Pharmaceutical Industry:BIG ET-1 (1-38) (HUMAN) is used as a research tool for understanding the mechanisms of blood pressure regulation and vascular tone. It aids in the development of drugs targeting endothelin receptors to treat cardiovascular diseases.
Used in Biomedical Research:
BIG ET-1 (1-38) (HUMAN) is utilized as a biomarker for studying the pathophysiology of cardiovascular diseases associated with endothelin-1 dysregulation. It helps in identifying potential therapeutic targets and evaluating the efficacy of new treatments.
Used in Drug Discovery:
BIG ET-1 (1-38) (HUMAN) is employed as a target for the development of drugs that modulate the activity of endothelin-1, potentially offering novel therapeutic options for the treatment of cardiovascular disorders.
Used in Diagnostics:
BIG ET-1 (1-38) (HUMAN) can be used as a diagnostic marker to assess the risk and progression of cardiovascular diseases related to endothelin-1 dysregulation, facilitating early intervention and personalized treatment strategies.
Check Digit Verification of cas no
The CAS Registry Mumber 121014-53-7 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,2,1,0,1 and 4 respectively; the second part has 2 digits, 5 and 3 respectively.Calculate Digit Verification of CAS Registry Number 121014-53:
(8*1)+(7*2)+(6*1)+(5*0)+(4*1)+(3*4)+(2*5)+(1*3)=57
57 % 10 = 7
So 121014-53-7 is a valid CAS Registry Number.
121014-53-7Upstream product
121014-53-7Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 121014-53-7
BIG ET-1 (1-38) (HUMAN)
