Parathyroid Hormone (PTH) (1-34), Bovine is a synthetically produced N-terminal fragment of the naturally occurring 84 amino acid parathyroid hormone. It consists of the first 34 amino acids of the hormone and retains the biological activity of the full-length PTH. This peptide is involved in calcium regulation, counteracting calcitonin, and plays a crucial role in maintaining calcium homeostasis in the body. It regulates serum phosphate levels and vitamin D biosynthesis, making it a significant component in the endocrine system.

12583-68-5

Post Buying Request

Basic information
1. Product Name: PARATHYROID HORMONE (1-34), BOVINE
2. Synonyms: ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE
3. CAS NO:12583-68-5
4. Molecular Formula: C183H288N54O50S2
5. Molecular Weight: 4108.71
6. EINECS: N/A
7. Product Categories: Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Neuroscience
Chemical Properties
1. Melting Point: N/A
2. Boiling Point: N/A
3. Flash Point: N/A
4. Appearance: /powder
5. Density: N/A
6. Refractive Index: N/A
7. Storage Temp.: −20°C
8. Solubility: ≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH
9. CAS DataBase Reference: PARATHYROID HORMONE (1-34), BOVINE(CAS DataBase Reference)
10. NIST Chemistry Reference: PARATHYROID HORMONE (1-34), BOVINE(12583-68-5)
11. EPA Substance Registry System: PARATHYROID HORMONE (1-34), BOVINE(12583-68-5)
Safety Data
1. Hazard Codes: N/A
2. Statements: N/A
3. Safety Statements: N/A
4. WGK Germany: 3
5. RTECS:
6. HazardClass: N/A
7. PackingGroup: N/A
8. Hazardous Substances Data: 12583-68-5(Hazardous Substances Data)

Suppliers
Usage
Upstream product
Downstream Products

12583-68-5 Suppliers

Recommended suppliers

12583-68-5 Usage

Uses

Used in Pharmaceutical Industry:
Parathyroid Hormone (1-34), Bovine is used as a therapeutic agent for the treatment of osteoporosis and hypoparathyroidism. It stimulates bone formation and increases bone mineral density, providing a potential treatment for patients with bone-related disorders.
Used in Research Applications:
PTH (1-34), Bovine is utilized as a research tool in various scientific studies to investigate the mechanisms of calcium regulation, bone metabolism, and the effects of PTH on target cells. It helps researchers understand the role of PTH in maintaining calcium homeostasis and its potential applications in treating bone-related diseases.
Used in Diagnostic Applications:
Parathyroid Hormone (1-34), Bovine can be employed in diagnostic assays to measure the levels of PTH in biological samples. This can aid in the diagnosis and monitoring of conditions related to calcium imbalances, such as hyperparathyroidism and hypoparathyroidism.
Used in Drug Development:
PTH (1-34), Bovine serves as a lead compound in the development of new drugs targeting bone metabolism and calcium regulation. Researchers can use this peptide to design and test novel therapeutic agents that mimic or modulate the effects of PTH on bone cells and calcium homeostasis.

Clinical Use

Active fragment (1-34) of endogenous human parathyroid hormone: Treatment of osteoporosis in postmenopausal women and men at increased risk of fractures Treatment of corticosteroid-induced osteoporosis

Drug interactions

Potentially hazardous interactions with other drugs None known

Metabolism

No metabolism or excretion studies have been performed. Peripheral metabolism of PTH is believed to occur by non-specific enzymatic mechanisms in the liver followed by excretion via the kidneys. The 24-hour urine excretion of calcium was reduced by a clinically unimportant amount (15%).

Check Digit Verification of cas no

The CAS Registry Mumber 12583-68-5 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 1,2,5,8 and 3 respectively; the second part has 2 digits, 6 and 8 respectively.
Calculate Digit Verification of CAS Registry Number 12583-68:
(7*1)+(6*2)+(5*5)+(4*8)+(3*3)+(2*6)+(1*8)=105
105 % 10 = 5
So 12583-68-5 is a valid CAS Registry Number.

InChI:InChI=1/C174H278N54O49S2/c1-19-93(16)142(228-156(260)110(46-51-137(243)244)208-167(271)126(82-230)224-168(272)139(90(10)11)225-131(235)73-178)171(275)210-106(42-47-127(179)231)143(247)193-78-133(237)200-111(52-59-278-17)153(257)218-119(68-97-76-188-84-197-97)161(265)219-121(70-129(181)233)163(267)213-114(62-87(4)5)145(249)194-79-132(236)199-101(37-25-28-54-175)146(250)217-118(67-96-75-187-83-196-96)160(264)212-113(61-86(2)3)144(248)195-80-134(238)201-125(81-229)166(270)209-112(53-60-279-18)154(258)206-108(44-49-135(239)240)150(254)204-105(41-32-58-191-174(185)186)155(259)226-140(91(12)13)169(273)211-109(45-50-136(241)242)152(256)216-117(66-95-74-192-100-36-24-23-35-99(95)100)159(263)215-116(64-89(8)9)157(261)205-104(40-31-57-190-173(183)184)148(252)202-102(38-26-29-55-176)147(251)203-103(39-27-30-56-177)149(253)214-115(63-88(6)7)158(262)207-107(43-48-128(180)232)151(255)221-123(72-138(245)246)165(269)227-141(92(14)15)170(274)222-120(69-98-77-189-85-198-98)162(266)220-122(71-130(182)234)164(268)223-124(172(276

12583-68-5Upstream product

12583-68-5Downstream Products

Post a RFQ

Cas No.:

Product Name:

Quantity:

Email:

Company name:

Valid Period:

Detailed Requirements:

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

What can I do for you?
Get Best Price

Get Best Price for 12583-68-5