EXENDIN-3, a peptide hormone structurally similar to glucagon-like peptide-1 (GLP-1), is derived from the saliva of the Gila monster, a venomous lizard native to the southwestern United States. This hormone has garnered significant interest in medical research due to its potential therapeutic applications, particularly in the management of type 2 diabetes. EXENDIN-3 exhibits the ability to stimulate insulin release from the pancreas, thereby reducing blood sugar levels. Furthermore, it slows gastric emptying, inducing a sense of satiety and decreasing food consumption. Its capacity to promote the growth and survival of insulin-producing beta cells in the pancreas positions EXENDIN-3 as a promising candidate for diabetes treatment.
130357-25-4
Post Buying Request-
-
Basic information
- Product Name: EXENDIN-3
- Synonyms: EXENDIN-3;HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;M.W. 4202.57 C184H282N50O61S
- CAS NO:130357-25-4
- Molecular Formula: C184H282N50O61S
- Molecular Weight: 4202.57128
- EINECS: N/A
- Product Categories: Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;Hormones;LizardObesity Research;Obesity Peptides;Obesity Research;Other Obesity Research Products;Toxins and Venoms;Glucagon receptor and related
- Mol File: 130357-25-4.mol
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: EXENDIN-3(CAS DataBase Reference)
- NIST Chemistry Reference: EXENDIN-3(130357-25-4)
- EPA Substance Registry System: EXENDIN-3(130357-25-4)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 130357-25-4(Hazardous Substances Data)
130357-25-4 Suppliers
Recommended suppliers
130357-25-4 Usage
Uses
Used in Pharmaceutical Industry:EXENDIN-3 is used as a therapeutic agent for the treatment of type 2 diabetes. It functions by stimulating insulin release from the pancreas, which helps to lower blood sugar levels. This hormone also slows down the rate of gastric emptying, contributing to a feeling of fullness and reducing food intake, thereby aiding in diabetes management.
Used in Diabetes Management:
EXENDIN-3 is utilized as a diabetes management tool due to its ability to promote the growth and survival of insulin-producing beta cells in the pancreas. This attribute makes it a valuable asset in the development of treatments aimed at enhancing insulin production and improving overall glucose homeostasis in individuals with type 2 diabetes.
Check Digit Verification of cas no
The CAS Registry Mumber 130357-25-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,3,0,3,5 and 7 respectively; the second part has 2 digits, 2 and 5 respectively.Calculate Digit Verification of CAS Registry Number 130357-25:
(8*1)+(7*3)+(6*0)+(5*3)+(4*5)+(3*7)+(2*2)+(1*5)=94
94 % 10 = 4
So 130357-25-4 is a valid CAS Registry Number.
130357-25-4Upstream product
130357-25-4Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 130357-25-4
EXENDIN-3
