BETA-AMYLOID (1-43) is a peptide fragment derived from the amyloid precursor protein, predominantly found in the brains of individuals with Alzheimer's disease. This peptide is characterized by its propensity to form aggregates and plaques, which are believed to play a significant role in the neurodegeneration and cognitive decline associated with Alzheimer's. The involvement of BETA-AMYLOID (1-43) in disrupting neuronal function and communication is a key factor contributing to the impaired memory and cognitive abilities observed in the disease. Consequently, BETA-AMYLOID (1-43) has garnered substantial attention in Alzheimer's research, with the goal of elucidating its role in the disease's progression and exploring potential therapeutic strategies.
134500-80-4
Post Buying Request-
-
Basic information
- Product Name: BETA-AMYLOID (1-43)
- Synonyms: BETA-AMYLOID (1-43);BETA-AMYLOID (1-43) PEPTIDE;BETA-AMYLOID PEPTIDE [1-43], HUMAN;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT;H2N-D-A-E-F-R-H-D-S-G-Y-E-V-H-H-Q-K-L-V-F-F-A-E-D-V-G-S-N-K-G-A-I-I-G-L-M-V-G-G-V-V-I-A-T-OH;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-OH;A-BETA (1-43);AMYLOID BETA-PROTEIN (1-43)
- CAS NO:134500-80-4
- Molecular Formula: C207H318N56O62S1
- Molecular Weight: 4615.14
- EINECS: N/A
- Product Categories: Alzheimers and Neurodegenerative Disease Research;Amyloid beta Protein Fragments;Amyloid β Protein FragmentsNeuropeptides;Neurodegenerative Disease Peptides;β Amyloid Peptides;Amyloid beta-peptide and related;peptide;Neuroscience
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: BETA-AMYLOID (1-43)(CAS DataBase Reference)
- NIST Chemistry Reference: BETA-AMYLOID (1-43)(134500-80-4)
- EPA Substance Registry System: BETA-AMYLOID (1-43)(134500-80-4)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 134500-80-4(Hazardous Substances Data)
134500-80-4 Suppliers
Recommended suppliers
134500-80-4 Usage
Uses
Used in Pharmaceutical Research and Development:BETA-AMYLOID (1-43) is utilized as a target for drug discovery and development in the pharmaceutical industry. Its role in Alzheimer's disease makes it a critical component in the search for novel treatments aimed at reducing or preventing the formation of beta-amyloid plaques, thereby potentially slowing or halting the progression of the disease.
Used in Diagnostic Applications:
In the medical field, BETA-AMYLOID (1-43) serves as a biomarker for Alzheimer's disease. Its presence in the brain and cerebrospinal fluid can be detected through various diagnostic tests, aiding in the early identification and monitoring of the disease's progression.
Used in Neuroscientific Research:
BETA-AMYLOID (1-43) is employed as a subject of study in neuroscientific research to better understand the mechanisms by which it contributes to neurodegeneration. This research is vital for uncovering the pathophysiology of Alzheimer's and may lead to the development of new therapeutic approaches and interventions.
Used in Drug Screening and Testing:
In the context of drug screening and testing, BETA-AMYLOID (1-43) is used to evaluate the efficacy of potential Alzheimer's treatments. By observing the impact of various compounds on the aggregation and toxicity of BETA-AMYLOID (1-43), researchers can assess their potential as therapeutic agents.
Used in Biomarker Validation Studies:
BETA-AMYLOID (1-43) is also used in biomarker validation studies to confirm its reliability as an indicator of Alzheimer's disease presence and severity. These studies are essential for establishing the peptide as a standard diagnostic tool in clinical settings.
Check Digit Verification of cas no
The CAS Registry Mumber 134500-80-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,3,4,5,0 and 0 respectively; the second part has 2 digits, 8 and 0 respectively.Calculate Digit Verification of CAS Registry Number 134500-80:
(8*1)+(7*3)+(6*4)+(5*5)+(4*0)+(3*0)+(2*8)+(1*0)=94
94 % 10 = 4
So 134500-80-4 is a valid CAS Registry Number.
134500-80-4Upstream product
134500-80-4Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 134500-80-4
BETA-AMYLOID (1-43)
