135402-55-0
Post Buying Request-
-
Basic information
- Product Name: barbourin
- Synonyms: barbourin
- CAS NO:135402-55-0
- Molecular Formula:
- Molecular Weight: 0
- EINECS: N/A
- Product Categories: N/A
- Mol File: 135402-55-0.mol
- Article Data: 0
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: N/A
- Solubility: N/A
- CAS DataBase Reference: barbourin(CAS DataBase Reference)
- NIST Chemistry Reference: barbourin(135402-55-0)
- EPA Substance Registry System: barbourin(135402-55-0)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 135402-55-0(Hazardous Substances Data)
135402-55-0 Suppliers
Recommended suppliersmore
135402-55-0 Usage
Enzyme inhibitor
This platelet aggregation activation inhibitor (MW = 7700.52 g/mol; CAS 135402-55-0; Accession Number = P22827; Sequence: EAGEECDCGSP ENPCCDAATCKLRPGAQCADGLCCDQCRFMKKGTVCRVAKGDWN DDTCTGQSADCPRNGLYG) was isolated from the venom of the Southeastern Pigmy Rattlesnake (Sistrurus miliarius barbouri), the only of 52 venoms specific for integrin GPIIb-IIIa versus other integrins. Barbourin is highly homologous to other peptides of the viper venom GPIIb-IIIa antagonist family, but contains a Lys-Gly-Asp (KGD) in place of the canonical Arg-Gly-Asp (RGD) sequence needed to inhibit receptor function. Barbourin represents a new structural model for designing potent and GPIIb IIIa-specific, platelet aggregation inhibitors (See Eptifibatide for details on Mechanism of Action).Check Digit Verification of cas no
The CAS Registry Mumber 135402-55-0 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,3,5,4,0 and 2 respectively; the second part has 2 digits, 5 and 5 respectively.Calculate Digit Verification of CAS Registry Number 135402-55:
(8*1)+(7*3)+(6*5)+(5*4)+(4*0)+(3*2)+(2*5)+(1*5)=100
100 % 10 = 0
So 135402-55-0 is a valid CAS Registry Number.
135402-55-0Upstream product
135402-55-0Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 135402-55-0
barbourin
