Welcome to LookChem.com Sign In|Join Free

CAS

  • or

135402-55-0

Post Buying Request

135402-55-0 Suppliers

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier

135402-55-0 Usage

Enzyme inhibitor

This platelet aggregation activation inhibitor (MW = 7700.52 g/mol; CAS 135402-55-0; Accession Number = P22827; Sequence: EAGEECDCGSP ENPCCDAATCKLRPGAQCADGLCCDQCRFMKKGTVCRVAKGDWN DDTCTGQSADCPRNGLYG) was isolated from the venom of the Southeastern Pigmy Rattlesnake (Sistrurus miliarius barbouri), the only of 52 venoms specific for integrin GPIIb-IIIa versus other integrins. Barbourin is highly homologous to other peptides of the viper venom GPIIb-IIIa antagonist family, but contains a Lys-Gly-Asp (KGD) in place of the canonical Arg-Gly-Asp (RGD) sequence needed to inhibit receptor function. Barbourin represents a new structural model for designing potent and GPIIb IIIa-specific, platelet aggregation inhibitors (See Eptifibatide for details on Mechanism of Action).

Check Digit Verification of cas no

The CAS Registry Mumber 135402-55-0 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,3,5,4,0 and 2 respectively; the second part has 2 digits, 5 and 5 respectively.
Calculate Digit Verification of CAS Registry Number 135402-55:
(8*1)+(7*3)+(6*5)+(5*4)+(4*0)+(3*2)+(2*5)+(1*5)=100
100 % 10 = 0
So 135402-55-0 is a valid CAS Registry Number.

135402-55-0Upstream product

135402-55-0Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 135402-55-0