136697-70-6

Basic information

• Product Name: NEUROPEPTIDE F
• Synonyms: H-PRO-ASP-LYS-ASP-PHE-ILE-VAL-ASN-PRO-SER-ASP-LEU-VAL-LEU-ASP-ASN-LYS-ALA-ALA-LEU-ARG-ASP-TYR-LEU-ARG-GLN-ILE-ASN-GLU-TYR-PHE-ALA-ILE-ILE-GLY-ARG-PRO-ARG-PHE-NH2;NEUROPEPTIDE F;PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2
• CAS NO: 136697-70-6
• Molecular Weight: 0
• Product Categories: peptide
• Mol File: 136697-70-6.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Storage Temp.: -15°C
• CAS DataBase Reference: NEUROPEPTIDE F(CAS DataBase Reference)
• NIST Chemistry Reference: NEUROPEPTIDE F(136697-70-6)
• EPA Substance Registry System: NEUROPEPTIDE F(136697-70-6)

Safety Data

• Hazardous Substances Data: 136697-70-6(Hazardous Substances Data)

Usage

General Description

Neuropeptide F (NPF) is a neuropeptide found in the central nervous system of various animals, including insects and mammals. It has been shown to play a role in regulating food intake, energy balance, and stress responses. NPF is involved in the modulation of feeding behaviors, with studies showing that it can stimulate food intake and decrease activity levels. Additionally, NPF has been linked to the regulation of metabolism, reproduction, and circadian rhythms. Its functions are mediated through interactions with specific receptors in the brain and other tissues, making it a potentially important target for the development of treatments for metabolic and eating disorders.

Related news

NEUROPEPTIDE F (cas 136697-70-6) peptides act through unique signaling pathways to affect cardiac activity09/24/2019

Elucidating how neuropeptides affect physiology may result in delineating peptidergic mechanisms and identifying antagonists for application in basic and translational science. Human neuropeptide Y (NPY) regulates cardiac activity; frequently invertebrates contain orthologs of vertebrate peptide...detailed

Regulation of sleep by the short NEUROPEPTIDE F (cas 136697-70-6) (sNPF) in Drosophila melanogaster09/10/2019

The short neuropeptide F (sNPF), a neuropeptide in the central nervous system (CNS) of Drosophila melanogaster, is expressed in a large population of diverse neurons of brain. Most of these neurons are intrinsic interneurons of the mushroom bodies, which are the most prominent insect bilateral C...detailed

Molecular characterization of a short NEUROPEPTIDE F (cas 136697-70-6) signaling system in the tsetse fly, Glossina morsitans morsitans09/09/2019

Neuropeptides of the short neuropeptide F (sNPF) family are widespread among arthropods and found in every sequenced insect genome so far. Functional studies have mainly focused on the regulatory role of sNPF in feeding behavior, although this neuropeptide family has pleiotropic effects includin...detailed

ReportDrosophila NEUROPEPTIDE F (cas 136697-70-6) Signaling Independently Regulates Feeding and Sleep-Wake Behavior09/08/2019

SummaryProper regulation of sleep-wake behavior and feeding is essential for organismal health and survival. While previous studies have isolated discrete neural loci and substrates important for either sleep or feeding, how the brain is organized to coordinate both processes with respect to one...detailed

The short NEUROPEPTIDE F (cas 136697-70-6) modulates olfactory sensitivity of Bactrocera dorsalis upon starvation09/07/2019

The insect short neuropeptide F (sNPF) family has been shown to modulate diverse physiological processes, such as feeding, appetitive olfactory behavior, locomotion, sleep homeostasis and hormone release. In this study, we identified the sNPF (BdsNPF) and its receptor (BdsNPFR) in an important a...detailed

Characterization of a NEUROPEPTIDE F (cas 136697-70-6) receptor in the tsetse fly, Glossina morsitans morsitans09/06/2019

Neuropeptides related to mammalian neuropeptide Y (NPY) and insect neuropeptide F (NPF) are conserved throughout Metazoa and intimately involved in a wide range of biological processes. In insects NPF is involved in regulating feeding, learning, stress and reproductive behavior. Here we identifi...detailed

Functional characterization of mosquito short NEUROPEPTIDE F (cas 136697-70-6) receptors09/04/2019

Mosquito blood feeding transiently inhibits sugar- and host seeking through neuropeptide signaling. Short neuropeptide F (sNPF) is one of the neuromodulators involved in this regulation. Here, we identified the genes for the sNPF precursor and the sNPF receptor in the southern house mosquito, Cu...detailed

Optogenetic activation of short NEUROPEPTIDE F (cas 136697-70-6) (sNPF) neurons induces sleep in Drosophila melanogaster09/03/2019

Sleep abnormalities have widespread and costly public health consequences, yet we have only a rudimentary understanding of the events occurring at the cellular level in the brain that regulate sleep. Several key signaling molecules that regulate sleep across taxa come from the family of neuropep...detailed