Basic information

Product Name: AMYLIN (8-37) (RAT)
Synonyms: AMYLIN (8-37) (RAT);ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;H-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2;diabetes associated peptide amide*fragment 8-37 R;Amylin (8-37) (mouse, rat);Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
CAS NO:138398-61-5
Molecular Formula: C140H227N43O43
Molecular Weight: 3200.56
EINECS: N/A
Product Categories: Peptide
Mol File: 138398-61-5.mol

Chemical Properties

Melting Point: N/A
Boiling Point: N/A
Flash Point: N/A
Appearance: /
Density: 1.51±0.1 g/cm3(Predicted)
Refractive Index: N/A
Storage Temp.: -15°C
Solubility: N/A
CAS DataBase Reference: AMYLIN (8-37) (RAT)(CAS DataBase Reference)
NIST Chemistry Reference: AMYLIN (8-37) (RAT)(138398-61-5)
EPA Substance Registry System: AMYLIN (8-37) (RAT)(138398-61-5)

Safety Data

Hazard Codes: N/A
Statements: N/A
Safety Statements: N/A
WGK Germany:
RTECS:
HazardClass: N/A
PackingGroup: N/A
Hazardous Substances Data: 138398-61-5(Hazardous Substances Data)

Suppliers
Usage
SDS
Upstream product
Downstream Products

138398-61-5 Suppliers

Recommended suppliers

138398-61-5 Usage

Uses

Used in Pharmaceutical Industry:
AMYLIN (8-37) (RAT) is used as a therapeutic agent for diabetes treatment, as it can inhibit the action of amylin and reduce the formation of toxic amyloid aggregates in pancreatic beta cells, thereby improving blood sugar regulation.
Used in Obesity Treatment:
AMYLIN (8-37) (RAT) is used as an appetite suppressant and energy expenditure enhancer, as it has been investigated for its effects on appetite regulation and energy expenditure, showing promise as a potential treatment for obesity-related conditions.

Check Digit Verification of cas no

The CAS Registry Mumber 138398-61-5 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,3,8,3,9 and 8 respectively; the second part has 2 digits, 6 and 1 respectively.
Calculate Digit Verification of CAS Registry Number 138398-61:
(8*1)+(7*3)+(6*8)+(5*3)+(4*9)+(3*8)+(2*6)+(1*1)=165
165 % 10 = 5
So 138398-61-5 is a valid CAS Registry Number.

138398-61-5SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 19, 2017

Revision Date: Aug 19, 2017

1.Identification

1.1 GHS Product identifier

Product name	AMYLIN (8-37) (RAT)

1.2 Other means of identification

Product number	-
Other names	Amylin (8-37) (mouse,rat)

1.3 Recommended use of the chemical and restrictions on use

Identified uses	For industry use only.
Uses advised against	no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number	-
Service hours	Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:138398-61-5 SDS

138398-61-5Upstream product

138398-61-5Downstream Products

Post a RFQ

Cas No.:

Product Name:

Quantity:

Email:

Company name:

Valid Period:

Detailed Requirements:

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

What can I do for you?
Get Best Price

Get Best Price for 138398-61-5