GLP-2 (RAT) is a chemical with a specific purpose. Lookchem provides you with multiple data and supplier information of this chemical.
195262-56-7
Post Buying Request-
-
Basic information
- Product Name: GLP-2 (RAT)
- Synonyms: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAGON (146-178) (RAT);PROGLUCAGON (126-158) (RAT);M.W. 3796.17 C166H256N44O56S
- CAS NO:195262-56-7
- Molecular Formula: C166H256N44O56S
- Molecular Weight: 3796.13504
- EINECS: N/A
- Product Categories: Peptide;Glucagon receptor and related
- Mol File: 195262-56-7.mol
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: -15°C
- Solubility: N/A
- CAS DataBase Reference: GLP-2 (RAT)(CAS DataBase Reference)
- NIST Chemistry Reference: GLP-2 (RAT)(195262-56-7)
- EPA Substance Registry System: GLP-2 (RAT)(195262-56-7)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 195262-56-7(Hazardous Substances Data)
195262-56-7 Suppliers
Recommended suppliers
195262-56-7 Usage
Uses
Used in Pharmaceutical Industry:GLP-2 (RAT) is used as a therapeutic agent for promoting intestinal growth and repair in rats. Its application is particularly beneficial in conditions that involve damage or injury to the gastrointestinal tract, such as radiation-induced injury.
Used in Nutritional Industry:
GLP-2 (RAT) is used as a nutritional supplement to enhance nutrient absorption in rats. By increasing the efficiency of nutrient uptake, GLP-2 (RAT) can support overall health and well-being in rats.
Used in Research and Development:
GLP-2 (RAT) is used as a research tool in the study of gastrointestinal function and disease in rats. Its role in promoting intestinal growth, nutrient absorption, and reducing apoptosis makes it a valuable asset in understanding the mechanisms of gastrointestinal health and potential therapeutic interventions.
Used in Veterinary Medicine:
GLP-2 (RAT) is used as a veterinary medicine to treat gastrointestinal disorders in rats. Its ability to promote intestinal growth and repair, as well as reduce radiation-induced injury, makes it a valuable treatment option for various gastrointestinal conditions in rats.
Check Digit Verification of cas no
The CAS Registry Mumber 195262-56-7 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,9,5,2,6 and 2 respectively; the second part has 2 digits, 5 and 6 respectively.Calculate Digit Verification of CAS Registry Number 195262-56:
(8*1)+(7*9)+(6*5)+(5*2)+(4*6)+(3*2)+(2*5)+(1*6)=157
157 % 10 = 7
So 195262-56-7 is a valid CAS Registry Number.
195262-56-7Upstream product
195262-56-7Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 195262-56-7
GLP-2 (RAT)
