196109-31-6

Basic information

• Product Name: EXENDIN-4 (3-39)
• Synonyms: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-4 (3-39);EXENDIN (3-39);H-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;M.W. 3992.42 C176H272N46O58S
• CAS NO: 196109-31-6
• Molecular Formula: C176H272N46O58S
• Molecular Weight: 3992.38128
• Product Categories: Glucagon receptor and related;peptide
• Mol File: 196109-31-6.mol
• Article Data: 0

Chemical Properties

• Appearance: /
• Storage Temp.: -15°C
• CAS DataBase Reference: EXENDIN-4 (3-39)(CAS DataBase Reference)
• NIST Chemistry Reference: EXENDIN-4 (3-39)(196109-31-6)
• EPA Substance Registry System: EXENDIN-4 (3-39)(196109-31-6)

Safety Data

• Hazardous Substances Data: 196109-31-6(Hazardous Substances Data)

Usage

General Description

EXENDIN-4 (3-39) is a synthetic version of a naturally occurring hormone found in the saliva of the Gila monster, a venomous lizard native to the southwestern United States. This chemical is a potent and selective agonist of the glucagon-like peptide-1 (GLP-1) receptor, which plays a key role in regulating blood sugar levels and insulin secretion in the body. EXENDIN-4 (3-39) has been used in research to study its potential therapeutic effects on diabetes, obesity, and other metabolic disorders. It has also shown promise in the treatment of neurodegenerative diseases and stroke, by exerting neuroprotective and anti-inflammatory effects in preclinical studies. This chemical has attracted interest as a potential drug candidate for the treatment of various medical conditions.