GLUCAGON (1-37) (PORCINE) is a synthetic form of the hormone glucagon, originally derived from the pancreas of pigs. This peptide hormone, composed of 37 amino acids, is essential in the regulation of blood glucose levels. It facilitates the breakdown of glycogen in the liver, thus increasing the glucose levels in the blood, making it a significant component in the management of blood sugar.
62340-29-8
Post Buying Request-
-
Basic information
- Product Name: GLUCAGON (1-37) (PORCINE)
- Synonyms: OXYNTOMODULIN;OXYNTOMODULIN (PORCINE);HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;GLUCAGON 37;GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);ENTEROGLUCAGON
- CAS NO:62340-29-8
- Molecular Formula: C192H295N59O60S
- Molecular Weight: 0
- EINECS: N/A
- Product Categories: Glucagon receptor and related;peptide
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: N/A
- Solubility: N/A
- CAS DataBase Reference: GLUCAGON (1-37) (PORCINE)(CAS DataBase Reference)
- NIST Chemistry Reference: GLUCAGON (1-37) (PORCINE)(62340-29-8)
- EPA Substance Registry System: GLUCAGON (1-37) (PORCINE)(62340-29-8)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 62340-29-8(Hazardous Substances Data)
62340-29-8 Suppliers
Recommended suppliers
62340-29-8 Usage
Uses
Used in Medical Industry:GLUCAGON (1-37) (PORCINE) is used as a therapeutic agent for treating severe hypoglycemia in diabetic patients who are unable to consume food or drink. It serves as a critical intervention to rapidly increase blood glucose levels, preventing potential complications associated with low blood sugar.
Additionally, GLUCAGON (1-37) (PORCINE) is used as a potential therapeutic agent for various conditions, including cardiovascular disease and liver disorders. Its role in these applications is due to its influence on glucose metabolism and its potential to impact other physiological processes related to these conditions.
Check Digit Verification of cas no
The CAS Registry Mumber 62340-29-8 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 6,2,3,4 and 0 respectively; the second part has 2 digits, 2 and 9 respectively.Calculate Digit Verification of CAS Registry Number 62340-29:
(7*6)+(6*2)+(5*3)+(4*4)+(3*0)+(2*2)+(1*9)=98
98 % 10 = 8
So 62340-29-8 is a valid CAS Registry Number.
62340-29-8Upstream product
62340-29-8Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 62340-29-8
GLUCAGON (1-37) (PORCINE)
