ACTH (7-38) (HUMAN) is a synthetic version of the hormone adrenocorticotropic hormone (ACTH) that is naturally produced in the pituitary gland. This peptide hormone plays a crucial role in regulating the production and release of cortisol from the adrenal glands. It is used in research and clinical settings for various applications due to its synthetic nature, which allows for precise control and standardized dosing in experimental and medical applications.
68563-24-6
Post Buying Request-
-
Basic information
- Product Name: ACTH (7-38) (HUMAN)
- Synonyms: acth(7-38;ACTH 1-39;ACTH (7-38) (HUMAN);ADRENOCORTICOTROPIC HORMONE FRAGMENT 7-38;ADRENOCORTICOTROPIC HORMONE HUMAN FRAGMENT 7-38;ADRENOCORTICOTROPIC HORMONE (7-38) (HUMAN);FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE;H-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-OH
- CAS NO:68563-24-6
- Molecular Formula: C167H257N47O46
- Molecular Weight: 3659.11
- EINECS: N/A
- Product Categories: Adrenocorticotrophic Hormone (ACTH)Peptides and Proteins;Adrenocorticotropic Hormones (ACTH);Hormones;Peptides for Cell Biology;Pituitary Hormones;peptide
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: ACTH (7-38) (HUMAN)(CAS DataBase Reference)
- NIST Chemistry Reference: ACTH (7-38) (HUMAN)(68563-24-6)
- EPA Substance Registry System: ACTH (7-38) (HUMAN)(68563-24-6)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: 22-24/25
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 68563-24-6(Hazardous Substances Data)
68563-24-6 Suppliers
Recommended suppliers
68563-24-6 Usage
Uses
Used in Research Applications:ACTH (7-38) (HUMAN) is used as a research tool for studying the effects of ACTH on adrenal function. It helps researchers understand the mechanisms of cortisol production and the role of ACTH in the body's stress response.
Used in Clinical Diagnostics:
ACTH (7-38) (HUMAN) is used as a diagnostic agent to identify and monitor disorders related to cortisol production and adrenal function. Its standardized dosing allows for accurate assessment of adrenal function in patients with suspected adrenal disorders.
Used in Treatment of Adrenal Disorders:
ACTH (7-38) (HUMAN) is used as a therapeutic agent for the treatment of certain adrenal disorders, such as primary adrenal insufficiency (Addison's disease). Its synthetic nature and precise dosing enable targeted treatment and management of these conditions.
Used in Drug Development:
ACTH (7-38) (HUMAN) is used in the development of new drugs targeting the adrenal axis and cortisol production. Its synthetic nature and well-defined properties make it an ideal candidate for testing the efficacy and safety of novel compounds in preclinical and clinical studies.
Check Digit Verification of cas no
The CAS Registry Mumber 68563-24-6 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 6,8,5,6 and 3 respectively; the second part has 2 digits, 2 and 4 respectively.Calculate Digit Verification of CAS Registry Number 68563-24:
(7*6)+(6*8)+(5*5)+(4*6)+(3*3)+(2*2)+(1*4)=156
156 % 10 = 6
So 68563-24-6 is a valid CAS Registry Number.
68563-24-6Upstream product
68563-24-6Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 68563-24-6
ACTH (7-38) (HUMAN)
