Welcome to LookChem.com Sign In|Join Free

CAS

  • or
Sauvagine is a peptide hormone, first isolated from the skin of the South American frog Phyllomedusa sauvagei, with adrenocorticotropic hormone (ACTH)-releasing activity and antidiuretic activity. It is a bioactive compound that has been found to have various physiological effects on the body.

74434-59-6 Suppliers

Post Buying Request

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier
  • 74434-59-6 Structure
  • Basic information

    1. Product Name: SAUVAGINE
    2. Synonyms: SAUVAGINE;SAUVAGINE (FROG);PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;M.W. 4599.31 C202H346N56O63S
    3. CAS NO:74434-59-6
    4. Molecular Formula: C202H346N56O63S1
    5. Molecular Weight: 4599.31
    6. EINECS: N/A
    7. Product Categories: Peptide;CRFNeuropeptides;OthersPeptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Releasing Factors;CRF receptor and related
    8. Mol File: 74434-59-6.mol
  • Chemical Properties

    1. Melting Point: N/A
    2. Boiling Point: N/A
    3. Flash Point: N/A
    4. Appearance: /
    5. Density: N/A
    6. Refractive Index: N/A
    7. Storage Temp.: −20°C
    8. Solubility: N/A
    9. CAS DataBase Reference: SAUVAGINE(CAS DataBase Reference)
    10. NIST Chemistry Reference: SAUVAGINE(74434-59-6)
    11. EPA Substance Registry System: SAUVAGINE(74434-59-6)
  • Safety Data

    1. Hazard Codes: N/A
    2. Statements: N/A
    3. Safety Statements: N/A
    4. WGK Germany: 3
    5. RTECS:
    6. HazardClass: N/A
    7. PackingGroup: N/A
    8. Hazardous Substances Data: 74434-59-6(Hazardous Substances Data)

74434-59-6 Usage

Uses

Used in Pharmaceutical Industry:
Sauvagine is used as a research tool for studying the effects of ACTH-releasing hormones and their role in the regulation of stress response and fluid balance in the body. Its ability to stimulate the release of ACTH makes it a valuable compound for understanding the complex interactions within the endocrine system.
Used in Neuroscience Research:
Sauvagine is used as a neuroactive peptide in neuroscience research, particularly in the study of the central nervous system and its response to stress. It can help researchers understand the mechanisms behind stress-related disorders and potentially contribute to the development of new therapeutic strategies for such conditions.
Used in Endocrinology Research:
Sauvagine is used as a hormone in endocrinology research to investigate the role of ACTH in the regulation of adrenal gland function and the production of cortisol, a hormone involved in the body's stress response. This research can provide insights into the development of treatments for adrenal disorders and conditions related to cortisol imbalances.

Discovery

Sauvagine was first reported in the skin of the South American frog Phyllomedusa sauvagei in 1980. Novel forms of SVG were isolated in the skin of the Mexican giant leaf frog Pachymedusa dacnicolor in 20122 and the South American orange-legged leaf frog Phyllomedusa hypochondrialis in 2015.

Structure

The sauvagines of Phyllomedusa sauvagei (PS-SVG), Pachymedusa dacnicolor (PD-SVG), and Phyllomedusa hypochondrialis (PH-SVG) comprise 40 aa, 38 aa, and 40 aa residues, respectively, with a pyroglutamate at the N-terminus and an amidated C-terminus1–3 .? The sequence identity of PS-SVG with human CRH is 63%. The sequence identities of PS-SVG with carp urotensin-I, human urocortin-I, human urocortin-II, and human urocortin-III are 50%, 35%, 20%, and 25%, respectively.? PS-SVG, Mr 4599. Soluble in water and methanol.

Receptors

Two CRH receptors, type-1 and -2 CRH receptors (CRHR1 and CRHR2), have been identified in Xenopus laevis. PS-SVG has higher affinity to CRHR2 (Kd=0.9 nM) than to CRHR1 (Kd=51.4 nM). [Tyr0 , Gln1 , Leu17]SVG (YQL-SVG) and [Tyr0 , Gln1, Bpa17]SVG (YQB-SVG) have been identified as agonists.

Synthesis and release

PD-SVG cDNA encodes 80-aa precursors. Prepro PD-SVG consists of a signal peptide (22 aa), a spacer peptide (16 aa), a cryptic region, and a mature peptide of 38 aa residues at the C-terminus.

Biological functions

SVG stimulates ACTH release from the pituitary of rats and goldfish. In Xenopus, SVG stimulates the α-melanocyte-stimulating hormone and β-endorphin release from the pars intermedia of the pituitary. SVG in the skin is considered to be involved in chemical defense.

Check Digit Verification of cas no

The CAS Registry Mumber 74434-59-6 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 7,4,4,3 and 4 respectively; the second part has 2 digits, 5 and 9 respectively.
Calculate Digit Verification of CAS Registry Number 74434-59:
(7*7)+(6*4)+(5*4)+(4*3)+(3*4)+(2*5)+(1*9)=136
136 % 10 = 6
So 74434-59-6 is a valid CAS Registry Number.
InChI:InChI=1/C202H346N56O63S/c1-29-103(20)156(162(212)283)251-199(320)161(110(27)261)256-191(312)137(92-155(281)282)247-186(307)132(87-101(16)17)243-185(306)131(86-100(14)15)242-183(304)129(84-98(10)11)239-172(293)116(51-43-78-218-202(215)216)228-188(309)135(90-146(211)266)246-189(310)134(89-145(210)265)238-164(285)109(26)220-163(284)108(25)221-166(287)118(54-63-142(207)262)229-173(294)119(55-64-143(208)263)230-167(288)111(46-34-38-73-203)224-175(296)121(58-67-149(269)270)232-169(290)113(48-36-40-75-205)225-176(297)122(59-68-150(271)272)233-174(295)120(56-65-144(209)264)231-168(289)112(47-35-39-74-204)226-177(298)124(61-70-152(275)276)236-195(316)157(104(21)30-2)252-179(300)125(62-71-153(277)278)237-196(317)158(105(22)31-3)253-180(301)126(72-81-322-28)235-170(291)114(49-37-41-76-206)223-171(292)115(50-42-77-217-201(213)214)227-181(302)127(82-96(6)7)241-184(305)130(85-99(12)13)240-178(299)123(60-69-151(273)274)234-182(303)128(83-97(8)9)245-192(313)138(94-259)249-187(308)133(88-102(18)19)244-190(311)136(91-154(279)2

74434-59-6Upstream product

74434-59-6Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 74434-59-6