GLUCAGON (1-37) (PORCINE) is a peptide hormone consisting of 37 amino acids, sourced from the pancreas of pigs. It functions as a potent hyperglycemic agent, increasing blood sugar levels by prompting the liver to convert stored glycogen into glucose. This hormone is instrumental in research and clinical settings for studying glucose metabolism and is considered a potential treatment for hypoglycemia, as well as for conditions like type 1 diabetes and insulin resistance.
74870-06-7
Post Buying Request-
-
Basic information
- Product Name: GLUCAGON (1-37) (PORCINE)
- Synonyms: H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;GLUCAGON 37;GLUCAGON (1-37) (PORCINE);GLUCAGON 1-37;OXYNTOMODULIN;OXYNTOMODULIN (PORCINE);OxyntoModulin (bovine, dog, porcine) OXM (bovine, dog, porcine), Preproglucagon (53-89) (bovine, dog, porcine), Proglucagon (33-69) (bovine, dog, porcine), Glucagon-37 (bovine, dog, porcine)
- CAS NO:74870-06-7
- Molecular Formula:
- Molecular Weight:
- EINECS: N/A
- Product Categories: N/A
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: -15°C
- Solubility: N/A
- CAS DataBase Reference: GLUCAGON (1-37) (PORCINE)(CAS DataBase Reference)
- NIST Chemistry Reference: GLUCAGON (1-37) (PORCINE)(74870-06-7)
- EPA Substance Registry System: GLUCAGON (1-37) (PORCINE)(74870-06-7)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 74870-06-7(Hazardous Substances Data)
74870-06-7 Suppliers
Recommended suppliers
74870-06-7 Usage
Uses
Used in Research Applications:GLUCAGON (1-37) (PORCINE) is used as a research tool for studying the effects on glucose metabolism and its role in the regulation of blood sugar levels.
Used in Clinical Settings:
GLUCAGON (1-37) (PORCINE) is used as a potential treatment for hypoglycemia to counteract abnormally low blood sugar levels.
Used in Diabetes Management:
GLUCAGON (1-37) (PORCINE) is used as a therapeutic agent in the management of type 1 diabetes and insulin resistance, helping to improve glucose control and overall metabolic health.
Check Digit Verification of cas no
The CAS Registry Mumber 74870-06-7 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 7,4,8,7 and 0 respectively; the second part has 2 digits, 0 and 6 respectively.Calculate Digit Verification of CAS Registry Number 74870-06:
(7*7)+(6*4)+(5*8)+(4*7)+(3*0)+(2*0)+(1*6)=147
147 % 10 = 7
So 74870-06-7 is a valid CAS Registry Number.
74870-06-7Upstream product
74870-06-7Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 74870-06-7
GLUCAGON (1-37) (PORCINE)
