Roferon-A is a medication brand that contains the active ingredient interferon alfa-2a, a type of interferon protein essential for bolstering the body's immune system to combat viral infections and cancer cells. This therapeutic agent functions by enhancing immune recognition and targeting of abnormal cells, potentially exhibiting anti-inflammatory and antiviral properties.
76543-88-9
Post Buying Request-
-
Basic information
- Product Name: Roferon-A
- Synonyms: Roferon-A;IfnAlpha-2A;A.-Ifn;Aids000156;Aids-000156;alpha Ifn;Cdlpqthslonrralillaqmgrispfsclkdrhdfgfpqeefdgnqfqkaqaisvlhemiqqtfnlfstkdssatwdesllekfytelyqqlndleacviqevgveetplmnedsilavrkyfqritlylt;Interferon-.alpha.-consensus
- CAS NO:76543-88-9
- Molecular Formula:
- Molecular Weight: 0
- EINECS: N/A
- Product Categories: N/A
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: N/A
- Solubility: N/A
- CAS DataBase Reference: Roferon-A(CAS DataBase Reference)
- NIST Chemistry Reference: Roferon-A(76543-88-9)
- EPA Substance Registry System: Roferon-A(76543-88-9)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany:
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 76543-88-9(Hazardous Substances Data)
76543-88-9 Suppliers
Recommended suppliers
76543-88-9 Usage
Uses
Used in Oncology:Roferon-A is utilized as an antineoplastic agent for the treatment of specific cancer types, such as hairy cell leukemia, chronic myeloid leukemia, and AIDS-related Kaposi's sarcoma. It facilitates the immune system's ability to identify and neutralize cancerous cells, contributing to tumor regression and disease management.
Used in Hepatology:
In the field of hepatology, Roferon-A serves as a therapeutic intervention for chronic viral hepatitis B and C. It is instrumental in modulating the immune response to clear viral infections, thereby reducing liver inflammation and the risk of liver-related complications.
Used in Immunology:
Roferon-A, with its immune-stimulating properties, is applied in immunological treatments to enhance the body's natural defenses against various diseases, including those caused by viral and malignant agents.
The administration of Roferon-A is typically via injection, which can lead to side effects such as flu-like symptoms, fatigue, and mood changes, reflecting its potent immune-modulating capabilities.
Check Digit Verification of cas no
The CAS Registry Mumber 76543-88-9 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 7,6,5,4 and 3 respectively; the second part has 2 digits, 8 and 8 respectively.Calculate Digit Verification of CAS Registry Number 76543-88:
(7*7)+(6*6)+(5*5)+(4*4)+(3*3)+(2*8)+(1*8)=159
159 % 10 = 9
So 76543-88-9 is a valid CAS Registry Number.
76543-88-9Upstream product
76543-88-9Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 76543-88-9
Roferon-A
