Welcome to LookChem.com Sign In|Join Free

CAS

  • or

86168-78-7

Sermorelin, also known as Sermorelin Acetate, is a synthetic peptide hormone that functions as a growth hormone-releasing factor. It is designed to mimic the action of the naturally occurring hormone, GHRH (Growth Hormone-Releasing Hormone), and stimulates the release of growth hormone in the body. Sermorelin is used for various medical and therapeutic applications due to its ability to promote growth and cell regeneration.
Used in Pharmaceutical Industry:
Sermorelin is used as a growth hormone stimulant for the treatment of growth hormone deficiency in children and adults. It helps to increase growth hormone levels, leading to improved growth, muscle mass, and overall physical development.
Used in Endocrinology:
Sermorelin is used as a diagnostic tool for the characterization of growth hormone-releasing factor from human pancreatic islet tumors. This helps in understanding the underlying mechanisms of growth hormone regulation and the development of effective treatment strategies for related conditions.
Used in Sports and Fitness Industry:
Sermorelin is used as a performance-enhancing substance by athletes and bodybuilders to increase muscle mass, strength, and overall physical performance. However, it is important to note that the use of Sermorelin for such purposes may be against the rules of various sports organizations and can lead to potential health risks.
Used in Research and Development:
Sermorelin is used as a research tool for studying the role of growth hormone in various physiological processes, such as cell growth, regeneration, and metabolism. This helps in the development of new therapeutic agents and treatment strategies for growth-related disorders and conditions.

86168-78-7 Suppliers

Post Buying Request

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier
  • 86168-78-7 Structure

  • Basic information

    1. Product Name: Sermorelin
    2. Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
    3. CAS NO:86168-78-7
    4. Molecular Formula: C149H246N44O42S
    5. Molecular Weight: 3357.88
    6. EINECS: 1312995-182-4
    7. Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
    8. Mol File: 86168-78-7.mol
    9. Article Data: 0

  • Chemical Properties

    1. Melting Point: N/A
    2. Boiling Point: N/A
    3. Flash Point: N/A
    4. Appearance: White powder
    5. Density: 1.45 g/cm3
    6. Refractive Index: 1.649
    7. Storage Temp.: −20°C
    8. Solubility: Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
    9. Stability: Hygroscopic
    10. CAS DataBase Reference: Sermorelin(CAS DataBase Reference)
    11. NIST Chemistry Reference: Sermorelin(86168-78-7)
    12. EPA Substance Registry System: Sermorelin(86168-78-7)

  • Safety Data

    1. Hazard Codes: N/A
    2. Statements: N/A
    3. Safety Statements: N/A
    4. WGK Germany: 3
    5. RTECS:
    6. HazardClass: N/A
    7. PackingGroup: N/A
    8. Hazardous Substances Data: 86168-78-7(Hazardous Substances Data)

86168-78-7 Usage

Check Digit Verification of cas no

The CAS Registry Mumber 86168-78-7 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 8,6,1,6 and 8 respectively; the second part has 2 digits, 7 and 8 respectively.
Calculate Digit Verification of CAS Registry Number 86168-78:
(7*8)+(6*6)+(5*1)+(4*6)+(3*8)+(2*7)+(1*8)=167
167 % 10 = 7
So 86168-78-7 is a valid CAS Registry Number.
InChI:InChI=1/C149H246N44O42S/c1-20-77(13)116(191-122(211)81(17)168-132(221)104(66-113(204)205)178-121(210)79(15)167-123(212)88(152)62-84-39-43-86(198)44-40-84)145(234)185-102(63-83-32-23-22-24-33-83)138(227)193-118(82(18)197)146(235)186-103(65-111(155)202)137(226)189-108(71-196)142(231)182-101(64-85-41-45-87(199)46-42-85)136(225)175-93(38-31-56-165-149(161)162)126(215)174-91(35-26-28-53-151)131(220)190-115(76(11)12)143(232)184-97(58-72(3)4)124(213)166-68-112(203)170-94(47-49-109(153)200)128(217)180-100(61-75(9)10)135(224)188-106(69-194)140(229)169-80(16)120(209)172-92(37-30-55-164-148(159)160)125(214)173-90(34-25-27-52-150)127(216)179-99(60-74(7)8)134(223)181-98(59-73(5)6)133(222)176-95(48-50-110(154)201)129(218)183-105(67-114(206)207)139(228)192-117(78(14)21-2)144(233)177-96(51-57-236-19)130(219)187-107(70-195)141(230)171-89(119(156)208)36-29-54-163-147(157)158/h22-24,32-33,39-46,72-82,88-108,115-118,194-199H,20-21,25-31,34-38,47-71,150-152H2,1-19H3,(H2,153,200)(H2,154,201)(H2,155,202)(H2,156,208)(H,166,213)(H,16

86168-78-7SDS

SAFETY DATA SHEETS

According to Globally Harmonized System of Classification and Labelling of Chemicals (GHS) - Sixth revised edition

Version: 1.0

Creation Date: Aug 13, 2017

Revision Date: Aug 13, 2017

1.Identification

1.1 GHS Product identifier

Product name SERMORELIN

1.2 Other means of identification

Product number -
Other names Sermoreline

1.3 Recommended use of the chemical and restrictions on use

Identified uses For industry use only.
Uses advised against no data available

1.4 Supplier's details

1.5 Emergency phone number

Emergency phone number -
Service hours Monday to Friday, 9am-5pm (Standard time zone: UTC/GMT +8 hours).

More Details:86168-78-7 SDS

86168-78-7Upstream product

86168-78-7Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 86168-78-7