GRF (1-44) (PORCINE) is a synthetic peptide hormone derived from pigs, which functions as a growth hormone releasing factor. Composed of 44 amino acids, it stimulates the release of growth hormone from the pituitary gland and possesses anabolic effects that promote growth and development in the body.
88384-73-0
Post Buying Request-
-
Basic information
- Product Name: GRF (1-44) (PORCINE)
- Synonyms: GRF (porcine) SoMatocrinin (porcine), SoMatoliberin (porcine), Growth HorMone-Releasing Factor (porcine), GHRH (porcine), Growth HorMone-Releasing HorMone (porcine);SoMatocrinin (porcine), SoMatoliberin (porcine), Growth HorMone-Releasing Factor (porcine), GHRH (porcine), Growth HorMone-Releasing HorMone (porcine);GRF (porcine)|GHRF,porcine;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2;GHRF, PORCINE;GROWTH HORMONE RELEASING FACTOR PORCINE;GROWTH HORMONE-RELEASING FACTOR (1-44) (PORCINE);GROWTH HORMONE RELEASING FACTOR (1-44), AMIDE, PORCINE
- CAS NO:88384-73-0
- Molecular Formula: C219H365N73O66S1
- Molecular Weight: 5108.76
- EINECS: N/A
- Product Categories: N/A
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /powder
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: GRF (1-44) (PORCINE)(CAS DataBase Reference)
- NIST Chemistry Reference: GRF (1-44) (PORCINE)(88384-73-0)
- EPA Substance Registry System: GRF (1-44) (PORCINE)(88384-73-0)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 88384-73-0(Hazardous Substances Data)
88384-73-0 Suppliers
Recommended suppliers
88384-73-0 Usage
Uses
Used in Research and Medical Settings:GRF (1-44) (PORCINE) is used as a research tool for studying the effects of growth hormone on the body and its potential applications in treating growth hormone deficiencies or related conditions. Its role in stimulating growth hormone release makes it a valuable asset in understanding the mechanisms of growth and development.
Used in Pharmaceutical Development:
In the pharmaceutical industry, GRF (1-44) (PORCINE) is utilized for the development of drugs and therapies targeting growth hormone deficiencies. Its ability to stimulate growth hormone release can be harnessed to create treatments that address various health conditions related to growth and development.
Used in Sports and Performance Enhancement:
GRF (1-44) (PORCINE) may also be used in the sports and performance enhancement industry as a potential means to improve athletic performance and recovery. Its anabolic effects and ability to promote growth and development could be beneficial for athletes seeking to enhance their physical capabilities. However, it is important to note that the use of such substances in sports may be subject to regulations and restrictions due to their potential for abuse and health risks.
Check Digit Verification of cas no
The CAS Registry Mumber 88384-73-0 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 8,8,3,8 and 4 respectively; the second part has 2 digits, 7 and 3 respectively.Calculate Digit Verification of CAS Registry Number 88384-73:
(7*8)+(6*8)+(5*3)+(4*8)+(3*4)+(2*7)+(1*3)=180
180 % 10 = 0
So 88384-73-0 is a valid CAS Registry Number.
88384-73-0Upstream product
88384-73-0Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 88384-73-0
GRF (1-44) (PORCINE)
