GRF (1-44) (BOVINE) is a synthetic peptide that functions as a mimic of the growth hormone-releasing hormone (GHRH) found in bovine species. It stimulates the pituitary gland to release growth hormone, which promotes the growth and development of various body tissues.
Used in Research Settings:
GRF (1-44) (BOVINE) is used as a research tool for studying the effects of growth hormone on various physiological processes. It aids in understanding the role of growth hormone in tissue development and overall body growth.
Used in Pharmaceutical Development:
GRF (1-44) (BOVINE) is used as a potential therapeutic agent in the development of interventions for growth-related disorders. Its ability to stimulate growth hormone release makes it a candidate for treatments targeting conditions that involve impaired growth or development.
Used in Research Settings:
GRF (1-44) (BOVINE) is used as a research tool for studying the effects of growth hormone on various physiological processes. It aids in understanding the role of growth hormone in tissue development and overall body growth.
Used in Pharmaceutical Development:
GRF (1-44) (BOVINE) is used as a potential therapeutic agent in the development of interventions for growth-related disorders. Its ability to stimulate growth hormone release makes it a candidate for treatments targeting conditions that involve impaired growth or development.
88894-91-1
Post Buying Request-
-
Basic information
- Product Name: GRF (1-44) (BOVINE)
- Synonyms: GRF (bovine)|GRF (1-44) (BOVINE);YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2;GHRF BOVINE;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-GLY-ALA-LYS-VAL-ARG-LEU-NH2;GRF (1-44), AMIDE, BOVINE;GRF (1-44) (BOVINE);GROWTH HORMONE RELEASING FACTOR BOVINE;GROWTH HORMONE-RELEASING FACTOR (1-44) (BOVINE)
- CAS NO:88894-91-1
- Molecular Formula: C220H366N72O66S1
- Molecular Weight: 5107.77
- EINECS: N/A
- Product Categories: Peptide
- Mol File: 88894-91-1.mol
-
Chemical Properties
- Melting Point: N/A
- Boiling Point: N/A
- Flash Point: N/A
- Appearance: /powder
- Density: N/A
- Refractive Index: N/A
- Storage Temp.: −20°C
- Solubility: N/A
- CAS DataBase Reference: GRF (1-44) (BOVINE)(CAS DataBase Reference)
- NIST Chemistry Reference: GRF (1-44) (BOVINE)(88894-91-1)
- EPA Substance Registry System: GRF (1-44) (BOVINE)(88894-91-1)
-
Safety Data
- Hazard Codes: N/A
- Statements: N/A
- Safety Statements: N/A
- WGK Germany: 3
- RTECS:
- HazardClass: N/A
- PackingGroup: N/A
- Hazardous Substances Data: 88894-91-1(Hazardous Substances Data)
88894-91-1 Suppliers
Recommended suppliersmore
88894-91-1 Usage
Check Digit Verification of cas no
The CAS Registry Mumber 88894-91-1 includes 8 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 5 digits, 8,8,8,9 and 4 respectively; the second part has 2 digits, 9 and 1 respectively.Calculate Digit Verification of CAS Registry Number 88894-91:
(7*8)+(6*8)+(5*8)+(4*9)+(3*4)+(2*9)+(1*1)=211
211 % 10 = 1
So 88894-91-1 is a valid CAS Registry Number.
88894-91-1Upstream product
88894-91-1Downstream Products
Post a RFQ
1
What can I do for you?
Get Best Price
Get Best Price for 88894-91-1
GRF (1-44) (BOVINE)
