Welcome to LookChem.com Sign In|Join Free
  • or
HENAN SUNLAKE ENTERPRISE CORPORATION107444-51-9GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN//www.lookchem.com/300w/2010/072/107444-51-9.jpg
qq

Communicate with Supplier:

Ms. summer
Ms. summer: What can I do for you?

107444-51-9GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN CAS NO.107444-51-9

Min.Order Quantity:
1 Kilogram
Purity:
99%
Port:
China main port
Payment Terms:
D/A,D/P,T/T

Add to Inquiry Cart

Product Details

Keywords

  • GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN
  • 107444-51-9
  • C149H226N40O45

Quick Details

  • ProName: 107444-51-9GLUCAGON-LIKE PEPTIDE I FRA...
  • CasNo: 107444-51-9
  • Molecular Formula: C149H226N40O45
  • Appearance: detailed in specifcations
  • Application: Aripiprazole Intermediate functional...
  • DeliveryTime: within 5days
  • PackAge: as needed
  • Port: China main port
  • ProductionCapacity: 500 Metric Ton/Month
  • Purity: 99%
  • Storage: Keep in dry and cool condition
  • Transportation: by air or sea
  • LimitNum: 1 Kilogram
  • MF: C13H21O3PS

Superiority

our services

1.certificate of analysis (coa)

2.material safety data sheet (msds)

3.route of synthesis (ros)

4.method of aanlysis (moa)

5.nuclear magnetic resonance (nmr)

6.packing pictures and loading video before loading

7.free sample

9.factory audit

10.strong after-sale service

company information

henan sunlake enterprise corporation is located in henan province , the central plain of china , which enjoys favorable geogeaphical position and convenient transportion, the com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .sunlake is a professional manufacturer engaged in producing and selling chemicals,including organic & inorganic chemicals , pigments & dyestuffs , water treatment chemicals , food & feed additives and others . these products have been being well exported to europe , southeast asia , the middle east , africa , south america and some other countries and areas.we sincerely welcome foreign friends to visit our plant for cooperation. with the idea of "quality first,credit priority, excellent service", we are highly acknowledged by customers for good quality and competitive price. more importantly , the company has a strong r & d team, who are professional engineers and scholars with ph. d. .so we are confident to serve you better with our high - quality products and professional team.we are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market.we welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate.

Details

glucagon-like peptide i fragment 7-36 amide human basic information
product name: glucagon-like peptide i fragment 7-36 amide human
synonyms: preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;preproglucagon 78-107 amide;preproglucagon (78-107) amide (human);proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;glucagon-likepeptidei(7-36;his-ala-glu-gly-thr-phe-thr-ser-asp-val-ser-ser-tyr-leu-glu-gly-gln-ala-ala-lys-glu-phe-ile-ala-trp-leu-val-lys-gly-arg-nh2;h-his-ala-glu-gly-thr-phe-thr-ser-asp-val-ser-ser-tyr-leu-glu-gly-gln-ala-ala-lys-glu-phe-ile-ala-trp-leu-val-lys-gly-arg-nh2;haegtftsdvssylegqaakefiawlvkgr-nh2
cas: 107444-51-9
mf: c149h226n40o45
mw: 3297.63
einecs:
product categories: peptide;glucagon receptor and related
mol file: 107444-51-9.mol
glucagon-like peptide i fragment 7-36 amide human structure
glucagon-like peptide i fragment 7-36 amide human chemical properties
density 1.47
storage temp. −20°c
form powder
safety information
wgk germany 3
msds information
provider language
sigmaaldrich english
glucagon-like peptide i fragment 7-36 amide human usage and synthesis
usage diabetes ii - not yet an approved application
glucagon-like peptide i fragment 7-36 amide human preparation products and raw materials

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)