Welcome to LookChem.com Sign In|Join Free
  • or
Hangzhou Peptidego Biotech Co.,LtdExenatide acetate manufacturer//www.lookchem.com/300w/2009423/img/141732-76-5.gif
qq

Communicate with Supplier:

Mr. Eric
Mr. Eric: What can I do for you?

Exenatide acetate manufacturer CAS NO.141732-76-5

Min.Order Quantity:
1 Gram
Purity:
98% Min
Port:
hangzhou
Payment Terms:
L/C,D/A,D/P,T/T,Other

Add to Inquiry Cart

Product Details

Keywords

  • Exenatide acetate supplier
  • Exenatide acetate
  • high quality Exenatide acetate

Quick Details

  • ProName: Exenatide acetate manufacturer
  • CasNo: 141732-76-5
  • Molecular Formula: C186H286N50O62S
  • Appearance: White powder
  • Application: pharmaceutical ingredients ,research c...
  • DeliveryTime: 3days to 1month
  • PackAge: According client's requirements
  • Port: hangzhou
  • ProductionCapacity: 1000 Gram/Month
  • Purity: 98% Min
  • Storage: keep sealed and keep from direct light
  • Transportation: According client's requirements
  • LimitNum: 1 Gram

Superiority

our advantages:

1.product capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.

2. samples free trial: our company welcome samples to test our quality then make regular orders.

3. good service: the company have 24 hours online service and feedback to our clients ontime

4. quality guarantee: we have strict quality control system before our delivery and refunds or re-deliver if any quality problems.

5. fast delivery and safe shipping: the compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.

Details

name:exenatide acetate, exenatida

cas no:141732-76-5

formula: c186h286n50o62s

molecular:4246.62

sequence: hgegtftsdlskqmeeeavrlfiewlknggpssgappps

purity:98%

appearance: white powder

source: synthetic

also know as ac 2993, bydureon, byetta, exenatide synthetic, synthetic exendin-4

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

Related Keywords