Welcome to LookChem.com Sign In|Join Free
  • or
Chengdu Youngshe Chemical Co.,LtdHigh purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics
    x
  • Ms.Lory
  • Ms.Cecilia
  • Ms.Caroline1
qq

Communicate with Supplier:

Ms. Caroline
Ms. Caroline: What can I do for you?

High purity custom peptide FOXO4,FOXO4-DRI peptide,Senolytics CAS NO.89030-95-5

FOB Price:
USD 100.00-100.00 /Milligram Get Latest Price
Min.Order Quantity:
50 Milligram
Purity:
95%MIN
Port:
Chengdu
Payment Terms:
L/C,T/T,MoneyGram

Add to Inquiry Cart

Product Details

Keywords

  • foxo4-dri
  • foxo4
  • Senolytics

Quick Details

  • ProName: High purity custom peptide FOXO4,FOXO4...
  • CasNo: 89030-95-5
  • Molecular Formula: N/A
  • Appearance: White powder
  • Application: Active pharmaceutical intermediate
  • DeliveryTime: 3-5 working days after synthsized
  • PackAge: 1gram per bottle(plastic bottle or gla...
  • Port: Chengdu
  • ProductionCapacity: 1000 Gram/Month
  • Purity: 95%MIN
  • Storage: 1000g/Month
  • LimitNum: 50 Milligram
  • Moisture Content: N/A
  • Impurity: N/A
  • CAS: N/A
  • Color: white
  • shelf life: 2 years
  • brand: youngshe
  • Transportation:: DHL, FeDex and EMS

Superiority

high purity custom peptide foxo4,foxo4-dri,senolytics
foxo4 d-retro-inverso peptide,
also known as foxo4 dri peptide was first reported in 'targeted apoptosis of senescent cells restores tissue homeostasis in response to chemotoxicity and aging' by baar et al. foxo4 dri peptide comprising the amino acid sequence: ltlrkepaseiaqsileaysqngwanrrsggkrp, wherein the amino acids in said amino acid sequence are d-amino acid residues. foxo4 d-retro-inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

other hot sale peptides:

anti-aging skincare peptide acetyl hexapeptide-3 argireline cas: 616204-22-9

syn-ake cas:823202-99-9

anti-wrinkle peptide powder acetyl octapeptide-3 snap-8 cas 868844-74-0

skin lightening-whitening nonapeptide-1 melanostatine

skin whitening peptide decapeptide-12 lumixyl

anti hair loss ingredient procapil biotinoyl tripeptide-1 biotin-ghk

eyelash growth peptide myristoyl pentapeptide-17

matrixyl 3000 powder cas: 77727-17-4

collagen hexapeptide collaxyl hexapeptide-9

acetyl hexapeptide-38/adifyline for breast enlargement

semax and n-acetyl semax/cas:4037-01-8 80714-61-0

api melanotan ii and melanotan 2 in pharmaceutical grade

tb-500(thymosin beta-4)

bremelanotide cas 32780-32-8 pt141

liraglutide dmf preparation cas : 204656-20-2

foxo4-d-retro-inverso(dri) custom peptide senolytics peptide

order process

1. send us your request

2.confirm price,delivery time,payment term,your request and all details you care

3.sign contract and issue invoice

4.payment by your side

5.we arrange shipment immediately after confirm payment

6.delivery( door to door,around 5 working days)

7.follow-up service

packing

1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

courier

we will use your favorite courier,such as dhl,ups,tnt,fedex or ems. shipping by air is also available.

contact info:

ph/whatsapp/skype/wechat:+86-18108235634

cecilia(at)youngshechem.com

Details

chengdu youngshe chemical co.,ltd is a dynamic and progressive cosmetic peptides supplier in china. we are dedicating to be a professional, efficient,and reliable partner for global customers on cosmetic peptides. you can select more than 170 kinds of raw cosmetic peptide ingredients here.and we are keeping developing new products and continuously marketing them for sale.youngshe chem provide a one-stop service for raw cosmetic peptide ingredients.you will save lots of time ,energy, money and have a very pleasant experience with us.since dec,2014,youngshe group has expanded their business to botanical cosmetic active ingredients and related.

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)