Welcome to LookChem.com Sign In|Join Free
  • or
Chengdu Youngshe Chemical Co.,LtdPharmaceutical raw material CRF (human,rat)//www.lookchem.com/300w/201001/img/86784-80-7.jpg
    x
  • Ms.Lory
  • Ms.Cecilia
  • Ms.Caroline1
qq

Communicate with Supplier:

Ms. Caroline
Ms. Caroline: What can I do for you?

Pharmaceutical raw material CRF (human,rat) CAS NO.86784-80-7

FOB Price:
USD 1.00-1.00 /Gram Get Latest Price
Min.Order Quantity:
1 Gram
Purity:
98%
Port:
Chengdu
Payment Terms:
L/C,T/T,MoneyGram,Other

Add to Inquiry Cart

Product Details

Keywords

  • CRF (human,rat)
  • Corticotropin releasing factor
  • 86784-80-7

Quick Details

  • ProName: Pharmaceutical raw material CRF (human...
  • CasNo: 86784-80-7
  • Molecular Formula: C208H344N60O63S2
  • Appearance: white powder
  • Application: Active Pharmaceutical Intermediate
  • DeliveryTime: 2~5 working days
  • PackAge: glass/plastic bottle protected by bubb...
  • Port: Chengdu
  • ProductionCapacity: 500 Gram/Week
  • Purity: 98%
  • Storage: 2~8 ℃
  • Transportation: FedEx/DHL/EMS or by air.
  • LimitNum: 1 Gram
  • Moisture Content: 0
  • Impurity: 0
  • Appearance: blue powder
  • Samples: available
  • Grade: cosmetic
  • MSDS/COA: available
  • Shelf life: 24 months
  • Source: synthesis
  • Stability: stable
  • Delivery: promptly from stock

Superiority

chengdu youngshe chemical co.,ltd is a dynamic and progressive cosmetic peptides supplier in china. you can select more than 170 kinds of raw cosmetic peptide ingredients here.and we are keeping developing new products and continuously marketing them for sale.

Details

product description:


crf(human,rat),corticotropin releasing factor

cas no: 86784-80-7

formula: c208h344n60o63s2

molecular: 4757.45

sequence:h-ser-glu-glu-pro-pro-ile-ser-leu-asp-leu-thr-phe-his-leu-leu-arg-glu-val-leu-glu-met-ala-arg-ala-glu-gln-leu-ala-gln-gln-ala-his-ser-asn-arg-lys-leu-met-glu-ile-ile-nh?

purity:98%

appearance: white powder

source: synthetic

also know as corticoliberin, corticorelin, crf-41, crh

crf (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. the peptide hormone stimulates acth release from the anterior lobe of the pituitary gland. crf plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
the human sequence eeppisldltfhllrevlemaraeqlaqqahsnrklmeii amide also corresponds to the sequence of canine, feline, murine, and porcine crf.

shipping:


fedex/dhl/ems or by air.

packaging:


glass/plastic bottle protected by bubble film

our services:


more details or free sample, feel free to contact sylvia:-)

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)