USD $10.00-10.00 / Gram
USD $25.10-28.30 / Gram
USD $10.00-10.00 / Gram
USD $25.10-28.30 / Gram
USD $25.10-28.30 / Gram
USD $10.00-10.00 / Gram
USD $25.10-28.30 / Gram
USD $2.00-10.00 / Kilogram
USD $10.00-10.00 / Gram
chengdu youngshe chemical co.,ltd is a dynamic and progressive cosmetic peptides supplier in china. you can select more than 170 kinds of raw cosmetic peptide ingredients here.and we are keeping developing new products and continuously marketing them for sale.
product description:
enfuvirtide acetate
cas no: 159519-65-0
formular: c204h301n51o64
molecular:4491.87
sequence: ac-ytslihslieesqnqqekneqelleldkwaslwnwf-nh2
purity:98%
appearance: white powder
source: synthetic
also known as: pentafuside, fuzeon, dp178, t-20, t 20 (peptide), dp 178
shipping:
fedex/dhl/ems or by air.
packaging:
glass/plastic bottle protected by bubble film
our services:
more details or free sample, feel free to contact sylvia:-)