SERMORELIN CAS NO.86168-78-7

FOB Price:: USD 500.00-500.00 /Gram Get Latest Price

Min.Order Quantity:: 1000 Gram

Purity:: 99.5（%）

Port:: tianjin china

Payment Terms:: L/C,T/T,MoneyGram

Add to Inquiry Cart

Product Details

Keywords

SERMORELIN
Sermoreline; Sermorelina; Sermorelinum
86168-78-7

Quick Details

ProName: SERMORELIN
CasNo: 86168-78-7
Molecular Formula: C149H246N44O42S
Appearance: appearance White powder
Application: Widely used in cosmetics, medicine, be...
DeliveryTime: 3day
PackAge: 1000 g/aluminum foil bag
Port: tianjin china
ProductionCapacity: 10 Metric Ton/Month
Purity: 99.5（%）
Storage: Dry and ventilated
Transportation: shipping
LimitNum: 1000 Gram
Moisture Content: PH (0.1% aqueous solution) : 6.0 ~ 7.5
Impurity: Protein: 0.1% or less
Light transmittance (0.1% aqueous solution) : 0.1% or greater: Light transmittance (0.1% aqueous solu...

Superiority

chengdu and import and export trade co., ltd., who registered capital of 10 million yuan, nearly to $2 million, we have a pharmaceutical raw materials factory production of pharmaceutical raw materials, and a reagent r&d center, and we do research and development production of reagent tens of thousands of species. our aim is quality strives for the survival. seek development by credit reputation. our products have big price advantage in europe south america and so on .and our company also has the advantage of high quality in africa. in the past two years our products has reached more than 30 countries in the world, europe. south america. north america, southeast asia, africa, etc. we welcome all over the world with the best quality and lowest price friend common cooperation and common development!the quality of our products meet all international standards, the german advanced equipment are imported equipment two laboratories, individual, on scale management concept, our aim is;with the highest quality. the lowest price. the best service to meet the new and old customers around the world, develop together for a better future!

Details

keywords

sermorelin
sermorelin acetate
hgh stimulator

quick details

proname: sermorelin good quality low price
casno: 86168-78-7
appearance: white powder
application: for research only
deliverytime: prompt
package: aluminum foil bag,bottle, customized
port: shanghai, hk
productioncapacity: 100 gram/month
purity: 98%
storage: in refridge
transportation: ems,dhl,fedex,tnt,hkems,hkdhl
limitnum: 1 gram
related substances: sermorelin
residue on ignition: na
heavy metal: na
valid period: na

superiority

1, factory price, top quality guaranteed

2, fast delivery

3, coa/hplc/hnmr available

4, reliable provider & satisfactory service

details

product name	sermorelin
chemical name	sermorelin;sermorelin acetate;yadaiftnsyrkvlgqlsarkllqdimsr-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2 human;h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;growth hormone releasing factor (1-29), amide, human;grf (1-29) amide (human)
cas no.	86168-78-7
formula	c149h246n44o42s
color	white powder
application	to be the shortest fully functional fragment of ghrh.[1] it is used as a test for growth hormone secretion

1,about sermorelin

sermorelin is a growth hormone releasing hormone (ghrh) analogue. it is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human growth hormone releasing hormone, and is thought to be the shortest fully functional fragment of ghrh.[1] it is used as a test for growth hormone secretion. it is also used as doping substance in sports due to its correlation with increased growth of muscular and skeletal tissue.[3] sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

sermorelin is a synthetic hormone that has been proven to aid in raising levels of igf-1 or human growth hormone levels.