| 22007-72-3 | Quercetin 7-O-α- L-Rhamnopyranoside with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 117-39-5 | Quercetin with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 60778-02-1 | Quercetin-3-O-beta-D-glucose-7-O-beta-D-gentiobioside with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 22688-79-5 | Quercetin-3-O-glucuronide with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 631-01-6 | Quillaic acid with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| Quercetin-3-O-arabinoside with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 6151-25-3 | Quercetin dihydrate with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 522-12-3 | Quercitroside with high qulity | Wuhan Prominence Bio-technology Co., Ltd |
| 6119-70-6 | Quinine sulfate dihydrate | Wuhan Prominence Bio-technology Co., Ltd |
| 84087-01-4 | Quinclorac | Wuhan Prominence Bio-technology Co., Ltd |
| 118803-81-9 | QUINOLINE-3-CARBOXYLIC ACID | Wuhan Prominence Bio-technology Co., Ltd |
| 1328-53-6 | Quality Phthalocyanine Green G CAS NO.1328-53-6 | Weifang Tansen Yiang international trading co., LTD |
| 68424-95-3 | Quaternary ammonium compounds,di-C8-10-alkyldimethy,chlorides | Changzhou Xuanming Chemical Co., Ltd. |
| 882670-95-3 | Quinazoline-2,6-diamine manufacturer high quality | Shanghai AngewChem Co., Ltd. |
| 1799733-46-2 | QUINOXALINE,3-CHLORO-2-(1,1-DIFLUORO-3-BUTEN-1-YL)-6-METHOXY - CAS NO.1799733-46-2 | Changzhou Pesan Chemical Co.,Ltd |
| 6119-47-7 | Quinine hydrochloride dihydrate CAS NO.: 6119-47-7 | Changchun Artel lmport and Export trade company |
| 6119-47-7 | Quinine hydrochloride dihydrateCAS NO.: 6119-47-7 | Changchun Artel lmport and Export trade company |
| 61789-77-3 | Quaternary ammonium compounds, dicoco alkyldimethyl, chlorides CAS NO.61789-77-3 CAS NO.61789-77-3 | Weifang Tansen Yiang international trading co., LTD |
| 1613-37-2 | quinoline 1-oxide | Wuhan Prominence Bio-technology Co., Ltd |
| 111974-72-2 | Quetiapine fumarate 99% Manufactuered in China best quality | Wuhan Zenuo Biological Medicine Technology Co Ltd |
| 6151-25-3 | Quercetin Soluble | EXCELLENT HEALTH PRODUCTS CO.,LTD |
| 144-55-8 | Quinine Antiparasitic drugs | Baoji Guokang Healthchem co.,ltd |
| 130-95-0 | Quinine Antimalarial drugs | Baoji Guokang Healthchem co.,ltd |
| 117-39-5 | Quercetin CAS NO.: 117-39-5CAS NO.: 117-39-5 | Changchun Artel lmport and Export trade company |
| 60676-86-0 | Quartz sand CAS NO.60676-86-0 CAS NO.60676-86-0 | Changchun Artel lmport and Export trade company |
| QYTLPKTAGGD-C | Research Peptide Biotechnology Co., Ltd. |
| QYRLPSGKCPVFGKGIIIEN | Research Peptide Biotechnology Co., Ltd. |
| QYPGCSLVF | Research Peptide Biotechnology Co., Ltd. |
| QYPGCSLV | Research Peptide Biotechnology Co., Ltd. |
| QYLAGLSTLPGNPAIASL | Research Peptide Biotechnology Co., Ltd. |
| QYIKANSKFIGITE | Research Peptide Biotechnology Co., Ltd. |
| QYIHSANVL | Research Peptide Biotechnology Co., Ltd. |
| QYHKMKKILF | Research Peptide Biotechnology Co., Ltd. |
| QYDVIIQHPADMSWC | Research Peptide Biotechnology Co., Ltd. |
| QYDGDSANAAEE-cys-KLH | Research Peptide Biotechnology Co., Ltd. |
| QYAVIIQHPADMSWC | Research Peptide Biotechnology Co., Ltd. |
| QY(T-p)LPKTAGGD-C | Research Peptide Biotechnology Co., Ltd. |
| QY | Research Peptide Biotechnology Co., Ltd. |
| QWLPELAR | Research Peptide Biotechnology Co., Ltd. |
| QWGPCLQCLWALLQASQY | Research Peptide Biotechnology Co., Ltd. |
| QWFVGLSPTVWLSAI | Research Peptide Biotechnology Co., Ltd. |
| QWF | Research Peptide Biotechnology Co., Ltd. |
| QVYSLIRPNENPAHK | Research Peptide Biotechnology Co., Ltd. |
| QVYGFVRACLRRLVPPGLWG | Research Peptide Biotechnology Co., Ltd. |
| QVVHWYYRPDLTIPEIPPKPGELKTELLGLKERRHEPHVSQQ | Research Peptide Biotechnology Co., Ltd. |
| QVTPPGNGCPKTEV | Research Peptide Biotechnology Co., Ltd. |
| QVSDMGVIHPLYK | Research Peptide Biotechnology Co., Ltd. |
| QVRTIIVNHVNDTWGL | Research Peptide Biotechnology Co., Ltd. |
| QVRQRYLYTDDAQQTEAHLE | Research Peptide Biotechnology Co., Ltd. |
| QVLAQDLLHPSAQSELR | Research Peptide Biotechnology Co., Ltd. |
| QVKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDMLIKKLKSFDY HQFVDETNDKIREVTQ | Research Peptide Biotechnology Co., Ltd. |
| QVHPDTGISSK | Research Peptide Biotechnology Co., Ltd. |
| QVGALYNEKV | Research Peptide Biotechnology Co., Ltd. |
| QVFFELNGQLR | Research Peptide Biotechnology Co., Ltd. |
| QVESTAGSLQGQWRG | Research Peptide Biotechnology Co., Ltd. |
| QVDFQKTMKVTGVTTQGVKS | Research Peptide Biotechnology Co., Ltd. |
| Quinoline-Val-Asp-Difluorophenoxymethylketone | Research Peptide Biotechnology Co., Ltd. |
| QTSRLRDHYLIGKKLGQ | Research Peptide Biotechnology Co., Ltd. |
| QTQQPQQPFP | Research Peptide Biotechnology Co., Ltd. |
| QTNLLGQVFKVANDALKILPI | Research Peptide Biotechnology Co., Ltd. |
| QTMSFPW | Research Peptide Biotechnology Co., Ltd. |
| QTIEPGWLYITAHR | Research Peptide Biotechnology Co., Ltd. |
| QTEIYKGK | Research Peptide Biotechnology Co., Ltd. |
| QTEDRQLRSSIERVINC | Research Peptide Biotechnology Co., Ltd. |
| QTDDNHSNVLWAGFSR | Research Peptide Biotechnology Co., Ltd. |
| QTARK(me3)STGGKAPRKQLK(FITC) | Research Peptide Biotechnology Co., Ltd. |
| QSWVHQIALRMEVLGCEAQD | Research Peptide Biotechnology Co., Ltd. |
| QSRGPDIPPEHHEEP-NH2 | Research Peptide Biotechnology Co., Ltd. |
| QSQQAFSPVSGDGWLFPWAY-hA(N3)-amide | Research Peptide Biotechnology Co., Ltd. |
| QSPAILSVSPGERVS | Research Peptide Biotechnology Co., Ltd. |
| QSNGEGIGVFQQSSK | Research Peptide Biotechnology Co., Ltd. |
| QSLLTGVQPEVPTSK | Research Peptide Biotechnology Co., Ltd. |
| QSLAAYNQRKADLVN | Research Peptide Biotechnology Co., Ltd. |
| QSISNSESGPR | Research Peptide Biotechnology Co., Ltd. |
| QSILTKSRSVIEQGG | Research Peptide Biotechnology Co., Ltd. |
| qsileaysqpprrrqrrkkrg | Research Peptide Biotechnology Co., Ltd. |
| qsileapprrrqrrkkrg | Research Peptide Biotechnology Co., Ltd. |
| QSHYRHISPAQV | Research Peptide Biotechnology Co., Ltd. |
| QSGYNARFCRGPGCM-NH2 | Research Peptide Biotechnology Co., Ltd. |
| QSGSPLESGQR | Research Peptide Biotechnology Co., Ltd. |
| QSGRDGY | Research Peptide Biotechnology Co., Ltd. |
| QSGLATANGKP | Research Peptide Biotechnology Co., Ltd. |
| QSAGFTAGL | Research Peptide Biotechnology Co., Ltd. |
| QRTSQHGLYY | Research Peptide Biotechnology Co., Ltd. |
| QRTESIIHRALYYDLIS | Research Peptide Biotechnology Co., Ltd. |
| QRSLRVGWFDLL-hA(N3)-amide | Research Peptide Biotechnology Co., Ltd. |
| QRQYGDVFKGDLNPKPQGQR | Research Peptide Biotechnology Co., Ltd. |
| QRQRREMVAQ | Research Peptide Biotechnology Co., Ltd. |
| QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP | Research Peptide Biotechnology Co., Ltd. |
| QRPRLSHKGPMPF-NH2 | Research Peptide Biotechnology Co., Ltd. |
| QRPRLSHKGPMPFCK(Biotin) | Research Peptide Biotechnology Co., Ltd. |
| QRPRLSHKGPMPFC | Research Peptide Biotechnology Co., Ltd. |
| QRPRLSHKGPMPF | Research Peptide Biotechnology Co., Ltd. |
| QRPRLSHK(γ-Glu-Pal)GPMPF-NH2 | Research Peptide Biotechnology Co., Ltd. |
| QRPLCPEEKQRHLDKKKRFH | Research Peptide Biotechnology Co., Ltd. |
| QRPILTIIT | Research Peptide Biotechnology Co., Ltd. |
| QRNREILDESLRLLD | Research Peptide Biotechnology Co., Ltd. |
| QRLSTGSRINSAKDDAAGLQIA | Research Peptide Biotechnology Co., Ltd. |
- About us - Payment - Contact us - Links - Help Center - Disclaimer
- SiteMap | Product SiteMap | New CAS | Cas Database | Article Data | Product Name | Chemical Catalog | Manufacturers | VIP Product | Suppliers
- ©2008 LookChem.com,License:ICP NO.lookchem:Zhejiang16009103 complaints:service@lookchem.com
- [Hangzhou]86-0571-87562588,87562578,87562573 Our Legal adviser: Lawyer