475221-20-6 Usage
Uses
Used in Neuroscience Research:
AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 is used as a Nogo-66 receptor antagonist peptide for studying the preliminary therapeutic effect after inhibition of Nogo-A in the cauda equina compression (CEC) model. This helps researchers understand the potential of this peptide in treating conditions related to nerve compression and damage.
Used in Autophagy Studies:
AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 is used as a research tool to determine the effects of Nogo-A/NgR1 on autophagic activation. Autophagy is a cellular process that helps maintain cellular homeostasis and is involved in various diseases, including neurodegenerative disorders. Understanding the role of Nogo-A/NgR1 in autophagy can provide insights into the development of therapeutic strategies for these conditions.
Used in Axonal Growth and Regeneration Research:
AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 is used as a Nogo-66 receptor antagonist peptide to study its role in Nogo-B mediated axonal branching using Schwann cells and sensory neurons of mice. This research can help in understanding the molecular mechanisms underlying axonal growth and regeneration, which is essential for the development of treatments for nerve injury and neurodegenerative diseases.
Biochem/physiol Actions
Myelin-derived axon outgrowth inhibitors, such as Nogo, may account for the lack of axonal regeneration in the central nervous system (CNS) after trauma in adult mammals. Nogo-66 can inhibit axonal outgrowth through an axonal Nogo-66 receptor (NgR). Competitive antagonists of NgR derived from amino-terminal peptide fragments of Nogo-66. The Nogo-66(1 40) antagonist peptide (NEP1 40) blocks Nogo-66 or CNS myelin inhibition of axonal outgrowth in vitro, demonstrating that NgR mediates a significant portion of axonal outgrowth inhibition by myelin. Intrathecal administration of NEP1 40 to rats with mid-thoracic spinal cord hemisection results in significant axon growth of the corticospinal tract, and improves functional recovery. Thus, Nogo-66 and NgR have central roles in limiting axonal regeneration after CNS injury, and NEP1-40 provides a potential therapeutic agent.
Check Digit Verification of cas no
The CAS Registry Mumber 475221-20-6 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 4,7,5,2,2 and 1 respectively; the second part has 2 digits, 2 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 475221-20:
(8*4)+(7*7)+(6*5)+(5*2)+(4*2)+(3*1)+(2*2)+(1*0)=136
136 % 10 = 6
So 475221-20-6 is a valid CAS Registry Number.