Welcome to LookChem.com Sign In|Join Free

Products

  • or
Home > Pharmaceutical > 475221 > 

475221-20-6

Refine

Refine

Country

Business Type

Certificate

Display

Basic Information
CAS No.: 475221-20-6
Name: AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Molecular Structure:
Molecular Structure of 475221-20-6 (AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2)
Formula: C206H324N56O65
Molecular Weight: 4625.11
Synonyms: 24:PN: WO2005059515 SEQID: 16 claimed protein; NEP1-40; Nogo receptor antagonistNEP1-40 (synthetic); Protein NEP1-40 (synthetic)
PSA: 1986.84000
LogP: 3.52320
  • Display:default sort

    New supplier

  • NEP(1-40);475221-20-6

  • Casno:

    475221-20-6

    NEP(1-40);475221-20-6

    Min.Order: 10 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    1.Professional synthesis laboratory and production base. 2.Strong synthesis team and service team. 3.Professional data management system. 4.We provide the professional test date and product information ,ex. HNMR ,CNMR,FNMR, HPLC/G

    Founded in 2011, Amadis Chemical Company Limited is an innovative manufacturer of chemical products and technical service providers. Our business includes sales, manufacture, and s

  •  Amadis Chemical Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-89925085

    Address:Watts Cosine.No.166.Xiangmao Road.

       Inquiry Now

  • Manufacturer supply CAS 475221-20-6 with best quality

  • Casno:

    475221-20-6

    Manufacturer supply CAS 475221-20-6 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • Nogo-66(1-40)

  • Casno:

    475221-20-6

    Nogo-66(1-40)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High-quality peptides at competitive prices.Appearance:Powder Storage:Cool dried place Package:PP bags inside,outside aluminium foil bag Application:Intermediate,peptides Transportation:Express, sea, air, land. Port:Shanghai,China

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • Nogo-66(1-40)

  • Casno:

    475221-20-6

    Nogo-66(1-40)

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

    Xiamen Jenny Chemical Technology Co., Ltd. is a modern high-tech enterprise specializing in the research, production, development, sales and self-support import and export of biolo

  • Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 16621006118

    Address:Room 402, No. 216, Nanshan Road, Huli District, Xiamen City

       Inquiry Now

  • Nogo-66 (1-40) with approved quality

  • Casno:

    475221-20-6

    Nogo-66 (1-40) with approved quality

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditides and natural extract etc. We are capable to supply you with any quanti

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  • Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • Nogo-66 (1-40) manufacturer

  • Casno:

    475221-20-6

    Nogo-66 (1-40) manufacturer

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers.Appearance:White powder Storage:keep sealed and keep from direct light Package:According client's requirements Application:pharmaceutica

    Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

  • Hangzhou Peptidego Biotech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0571-87213919

    Address:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN

       Inquiry Now

  • Nogo-66 (1-40)

  • Casno:

    475221-20-6

    Nogo-66 (1-40)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Do best quality products, erect the morality model Application:please email us, thanks

    Wuxi Morality Chemical Co., Ltd is specialized in the development and manufacture of industrial additives, bulk chemical intermediates, pharmaceutical raw materials and pesticide

  • Wuxi Morality Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-510-83597286 17768505220

    Address:B/7F, 321th WuYun Rd, Wanda Plaza, Wuxi City, 214174, China

       Inquiry Now

  • Total:9 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 475221-20-6