IBERIOTOXIN is a selective and reversible inhibitor of high-conductance calcium-activated potassium channels. It is a toxin purified from the Eastern Indian red scorpion Buthus tamulus and has been used as a recombinant form from Mesobuthus tamulus.

129203-60-7

Post Buying Request

Basic information
1. Product Name: IBERIOTOXIN
2. Synonyms: IBTX;IBTX (SCORPION, BUTHUS TAMULUS);IBERIOTOXIN;IBERIOTOXIN, BUTHUS TAMULUS;IBERIOTOXIN SCORPION BUTHUS TAMULUS;PGLU-PHE-THR-ASP-VAL-ASP-CYS-SER-VAL-SER-LYS-GLU-CYS-TRP-SER-VAL-CYS-LYS-ASP-LEU-PHE-GLY-VAL-ASP-ARG-GLY-LYS-CYS-MET-GLY-LYS-LYS-CYS-ARG-CYS-TYR-GLN [DISULFIDE BRIDGES: 7-28, 13-3, 17-3];RLBTX;PYR-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ
3. CAS NO:129203-60-7
4. Molecular Formula: C179H274N50O55S7
5. Molecular Weight: 4230.84786
6. EINECS: N/A
7. Product Categories: Ion Channel Modulating Peptides;Potassium Channel ModulatorsPeptides for Cell Biology;Monovalent Ion Channels;Potassium Channel ModulatorsCell Signaling and Neuroscience;Scorpion;Toxins and Venoms;Voltage-gated Ion Channels;Enzyme Inhibitors;Enzyme Inhibitors by Type;Other;Potassium channel
8. Mol File: 129203-60-7.mol
Chemical Properties
1. Melting Point: N/A
2. Boiling Point: °Cat760mmHg
3. Flash Point: °C
4. Appearance: /
5. Density: g/cm³
6. Refractive Index: N/A
7. Storage Temp.: −20°C
8. Solubility: H2O: 1 mg/mL, clear, colorless
9. CAS DataBase Reference: IBERIOTOXIN(CAS DataBase Reference)
10. NIST Chemistry Reference: IBERIOTOXIN(129203-60-7)
11. EPA Substance Registry System: IBERIOTOXIN(129203-60-7)
Safety Data
1. Hazard Codes: T+
2. Statements: 26/27/28
3. Safety Statements: 28-36/37-45
4. RIDADR: UN 3462 6.1/PG 2
5. WGK Germany: 3
6. RTECS: NH6107500
7. F: 3-10
8. HazardClass: N/A
9. PackingGroup: N/A
10. Hazardous Substances Data: 129203-60-7(Hazardous Substances Data)

Suppliers
Usage
Upstream product
Downstream Products

129203-60-7 Suppliers

Recommended suppliers

129203-60-7 Usage

Uses

Used in Biological Research:
IBERIOTOXIN is used as a selective probe for high-conductance calcium-activated potassium channels to study their function and role in various biological processes.
Used in Inflammasome Activation Studies:
IBERIOTOXIN is used as an inhibitor of large-conductance calcium-activated K+ channels to study its effect on the NLRP3 inflammasome activation in bone marrow-derived macrophages (BMDMs). This helps researchers understand the role of these channels in inflammatory responses and immune system regulation.
Used in Interleukin-1β Production Analysis:
IBERIOTOXIN is used to block Ca2+-activated K+ channels in order to determine the production of interleukin-1β (IL-1β) in bone marrow-derived dendritic cells (BMDCs) following inflammasome activation. This application aids in understanding the mechanisms of IL-1β production and its role in inflammation and immune responses.

Biological Activity

iberiotoxin is a 37 amino acid peptidyl toxin isolated from the scorpion mesobuthus tamulus and was shown to selectively block large conductance ca2+-activated k+ channels(bkca) in smooth muscle cells.in single channel recordings, iberiotoxin can reversibly block outward currents mediated by bkca in excised membrane patches from bovine aortic smooth muscle with an ic50 value of 250 pm. it is also a noncompetitive, partial inhibitor of charybdotoxin binding in bovine aortic sarcolemmal membrane vesicles (ki = 250 pm).[1]. galvez a, gimenez-gallego g, reuben j p, et al. purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion buthus tamulus. the journal of biological chemisty, 1990, 265(19): 11083-11090.

Biochem/physiol Actions

The single chain peptide iberiotoxin (IbTX) is a selective and reversible inhibitor of high-conductance calcium-activated potassium channels (PK,Ca). It occurs naturally in the venom of the scorpion Buthus tamulus. IbTX also modulates the binding of charybdotoxin (CbTX) to smooth muscle sarcolemmal membranes in a non-competitive manner. IbTX is similar in size to CbTX and shares considerable sequence homology with CbTX. However, IbTX differs in its overall charge in having one fewer basic and four more acidic residues than CbTX.

Check Digit Verification of cas no

The CAS Registry Mumber 129203-60-7 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 1,2,9,2,0 and 3 respectively; the second part has 2 digits, 6 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 129203-60:
(8*1)+(7*2)+(6*9)+(5*2)+(4*0)+(3*3)+(2*6)+(1*0)=107
107 % 10 = 7
So 129203-60-7 is a valid CAS Registry Number.

InChI:InChI=1/C179H274N50O55S7/c1-87(2)65-111-155(261)208-112(66-93-33-15-13-16-34-93)146(252)195-77-133(239)225-139(88(3)4)172(278)213-117(71-136(244)245)158(264)199-100(44-31-62-190-178(186)187)144(250)193-75-131(237)198-102(40-22-27-58-181)148(254)219-124(167(273)205-109(56-64-285-12)145(251)194-76-132(238)197-101(39-21-26-57-180)147(253)200-105(43-25-30-61-184)151(257)220-123-81-286-288-83-125(221-152(258)106(203-166(123)272)45-32-63-191-179(188)189)169(275)210-113(68-95-46-48-97(234)49-47-95)156(262)206-110(177(283)284)50-53-129(185)235)82-287-291-86-128(168(274)202-104(42-24-29-60-183)150(256)212-116(70-135(242)243)159(265)207-111)224-175(281)142(91(9)10)228-164(270)121(79-231)216-157(263)115(69-96-74-192-99-38-20-19-37-98(96)99)211-170(276)126-84-289-290-85-127(171(277)217-122(80-232)165(271)227-141(90(7)8)174(280)218-120(78-230)163(269)201-103(41-23-28-59-182)149(255)204-108(154(260)222-126)52-55-134(240)241)223-160(266)118(72-137(246)247)214-173(279)140(89(5)6)226-162(268)119(73-138(248)249)215-176(282)143

129203-60-7Upstream product

129203-60-7Downstream Products

Post a RFQ

Cas No.:

Product Name:

Quantity:

Email:

Company name:

Valid Period:

Detailed Requirements:

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

What can I do for you?
Get Best Price

Get Best Price for 129203-60-7