357952-10-4 Usage
Uses
Given the provided materials, there are no explicit uses listed for FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2. However, based on its potential biological activity, it can be hypothesized that this peptide may have applications in various fields, such as:
Used in Pharmaceutical Industry:
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 could be utilized as a therapeutic agent for targeting specific receptors or enzymes involved in disease pathways. Its precise role and mechanism of action would need to be determined through rigorous research and clinical trials.
Used in Research Applications:
In the field of biological research, this peptide may serve as a valuable tool for studying protein-protein interactions, receptor binding, and signal transduction pathways. It could be employed in assays and experiments to probe the molecular mechanisms underlying various physiological and pathological processes.
Used in Diagnostic Development:
The peptide's potential to bind with specific biological targets could be harnessed in the development of diagnostic tools, such as assays for detecting the presence or activity of certain proteins or enzymes associated with specific conditions.
Check Digit Verification of cas no
The CAS Registry Mumber 357952-10-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 3,5,7,9,5 and 2 respectively; the second part has 2 digits, 1 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 357952-10:
(8*3)+(7*5)+(6*7)+(5*9)+(4*5)+(3*2)+(2*1)+(1*0)=174
174 % 10 = 4
So 357952-10-4 is a valid CAS Registry Number.