Welcome to LookChem.com Sign In|Join Free

CAS

  • or

357952-10-4

Post Buying Request

357952-10-4 Suppliers

Recommended suppliersmore

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier
  • L-Isoleucinamide,L-phenylalanyl-L-threonyl-L-leucyl-L-seryl-L-leucyl-L-a-aspartyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-isoleucyl-L-methionyl-L-asparaginyl-L-isoleucyl-L-leucyl-L-phenylalanyl-L-

    Cas No: 357952-10-4

  • No Data

  • No Data

  • No Data

  • Antimex Chemical Limied
  • Contact Supplier
  • L-Isoleucinamide,L-phenylalanyl-L-threonyl-L-leucyl-L-seryl-L-leucyl-L-a-aspartyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-isoleucyl-L-methionyl-L-asparaginyl-L-isoleucyl-L-leucyl-L-phenylalanyl-L-

    Cas No: 357952-10-4

  • No Data

  • No Data

  • No Data

  • Chemlyte Solutions
  • Contact Supplier

357952-10-4 Usage

General Description

The chemical "FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2" is a peptide consisting of 37 amino acids, including phenylalanine (F), threonine (T), leucine (L), serine (S), aspartic acid (D), valine (V), proline (P), isoleucine (I), methionine (M), asparagine (N), alanine (A), lysine (K), and glutamine (Q). The peptide terminates with an amidated (NH2) group. This sequence may have potential biological activity, such as binding to receptors, enzymes, or other proteins in the body, and could be involved in various physiological processes or pathological conditions. Further research is needed to determine the exact function and effects of this peptide in biological systems.

Check Digit Verification of cas no

The CAS Registry Mumber 357952-10-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 3,5,7,9,5 and 2 respectively; the second part has 2 digits, 1 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 357952-10:
(8*3)+(7*5)+(6*7)+(5*9)+(4*5)+(3*2)+(2*1)+(1*0)=174
174 % 10 = 4
So 357952-10-4 is a valid CAS Registry Number.

357952-10-4Upstream product

357952-10-4Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 357952-10-4