Welcome to LookChem.com Sign In|Join Free
  • or
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 is a peptide composed of 37 amino acids, featuring a diverse array of amino acids such as phenylalanine, threonine, leucine, serine, aspartic acid, valine, proline, isoleucine, methionine, asparagine, alanine, lysine, and glutamine. The peptide is characterized by its terminal amidated (NH2) group, which may contribute to its potential biological activity. This sequence could interact with various receptors, enzymes, or proteins within the body, implicating it in a range of physiological processes and pathological conditions. Further investigation is required to elucidate the specific functions and impacts of this peptide in biological systems.

357952-10-4

Post Buying Request

357952-10-4 Suppliers

Recommended suppliers

  • Product
  • FOB Price
  • Min.Order
  • Supply Ability
  • Supplier
  • Contact Supplier

357952-10-4 Usage

Uses

Given the provided materials, there are no explicit uses listed for FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2. However, based on its potential biological activity, it can be hypothesized that this peptide may have applications in various fields, such as:
Used in Pharmaceutical Industry:
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 could be utilized as a therapeutic agent for targeting specific receptors or enzymes involved in disease pathways. Its precise role and mechanism of action would need to be determined through rigorous research and clinical trials.
Used in Research Applications:
In the field of biological research, this peptide may serve as a valuable tool for studying protein-protein interactions, receptor binding, and signal transduction pathways. It could be employed in assays and experiments to probe the molecular mechanisms underlying various physiological and pathological processes.
Used in Diagnostic Development:
The peptide's potential to bind with specific biological targets could be harnessed in the development of diagnostic tools, such as assays for detecting the presence or activity of certain proteins or enzymes associated with specific conditions.

Check Digit Verification of cas no

The CAS Registry Mumber 357952-10-4 includes 9 digits separated into 3 groups by hyphens. The first part of the number,starting from the left, has 6 digits, 3,5,7,9,5 and 2 respectively; the second part has 2 digits, 1 and 0 respectively.
Calculate Digit Verification of CAS Registry Number 357952-10:
(8*3)+(7*5)+(6*7)+(5*9)+(4*5)+(3*2)+(2*1)+(1*0)=174
174 % 10 = 4
So 357952-10-4 is a valid CAS Registry Number.

357952-10-4Upstream product

357952-10-4Downstream Products

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1 Customer Service

What can I do for you?
Get Best Price

Get Best Price for 357952-10-4