357952-10-4

Urocortin II, mouse

Min.Order: 1 Gram

FOB Price:  USD $ 150.0-3500.0

LIDE PHARMACEUTICALS LTD.was established in Apr.,2010. It is located in Jiangbei New District, Pukou District, Nanjing, which is the capital of total six dynasties in the Chinese history. We are a company that provides customized development and prod

LIDE PHARMACEUTICALS LTD.was established in Apr.,2010 located Nanjing. We are a company that provides customized development and production services (CDMO) for global chemical and

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 1 Kilogram

FOB Price:  USD $ 3.0-3.0

Dayangchem's R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. DayangChem can provide different quantitie

Dayang Chem (Hangzhou) Co.,Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredi

Manufacturer supply CAS 357952-10-4 with best quality

Min.Order: 1 Kilogram

FOB Price:  USD $ 139.0-210.0

WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is （Wen Xi Pharma）, including three subs

Urocortin III, mouse

Min.Order: 1 Gram

FOB Price:  USD $ 1000.0-1000.0

Our competitive advantages are reflected in four dimensions: quality, process, price, and service. **Quality Advantages:** High purity and stability are key, ensuring the efficiency and safety of downstream product synthesis; optimized molecular str

Hangzhou Jinlan Pharm-Drugs Technology Co., Ltd. (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Pro

L-Isoleucinamide,L-phenylalanyl-L-threonyl-L-leucyl-L-seryl-L-leucyl-L-a-aspartyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-isoleucyl-L-methionyl-L-asparaginyl-L-isoleucyl-L-leucyl-L-phenylalanyl-L-

Min.Order: 100 Gram

FOB Price:  USD $ 1.9-2.9

Appearance:liquid Storage:Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials. Package:Grams, Kilograms Application:For R&D and commerical use Transportati

We are a team of industry experts, dedicated to delivering the best chemical solutions from quality suppliers across China. Putting our customers first, we take a holistic approach

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 10 Gram

FOB Price:  USD $ 0.0-0.0

Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

Urocortin III (mouse)

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

We have some laboratories focusing on technology development and custom synthesis and some Manufacturing bases which focuses on production and contract manufacturing in Zhejiang Hubei Shandong. Our quality control Dept. is engaged in the activities

Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

Urocortin III (mouse)

Min.Order: 0 Metric Ton

FOB Price:  USD $ 0.0-0.0

Jiangsu Congzhong Chemical Co., Ltd. product quality 1.The product quality has passed the professional production process and quality inspection. The quality of the products is widely acclaimed. 2.The products shall be packed in special standard

Jiangsu Congzhong Chemical Co., Ltd. is located in Hushuguan economic and Technological Development Zone, Suzhou high tech Zone. It is a civilian chemical enterprise that produces

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

L-Isoleucinamide,L-phenylalanyl-L-threonyl-L-leucyl-L-seryl-L-leucyl-L-a-aspartyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-isoleucyl-L-methionyl-L-asparaginyl-L-isoleucyl-L-leucyl-L-phenylalanyl-L-

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

hight degree of purity Application:Fine chemical intermediates, used as the main raw material for he synthesis of various pesticides, medicines, surfactants, polymer monomers, Ond Ontifungal agents

Antimex Chemical Limied, was founded in 2001, we are specializing in manufacturing & researching of Active pharmaceutical Ingredients,Veterinary pharm APIs,cosmetic ingredients,and

Urocortin III, mouse

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

We provide customized and high-quality Urocortin III, mouse product for your project. Application:For research use only.

BOC Sciences is a brand of BOCSCI Inc. We leverage our wide spectrum of business in the fields of development, manufacturing, marketing, and distribution to help you make best-info

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

Hello, Dear friend!I'm Hanson from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by email in time. Application:Used as pharm

Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

UrocortinIII(mouse)

Min.Order: 1 Milligram

FOB Price:  USD $ 0.0-0.0

GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

Xiamen Jenny Chemical Technology Co., Ltd. is a modern high-tech enterprise specializing in the research, production, development, sales and self-support import and export of biolo

UrocortinIII,mouse

Min.Order: 1 Gram

FOB Price:  USD $ 0.0-0.0

Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

Watson International Ltd is the business department of FCAD Group. FCAD helps clients from different fields to develop their required fine chemicals or formulations. From pharmaceu

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 1 Milligram

FOB Price:  USD $ 10.0-10.0

Q1:Are you manufacturer or trading company? A1: Manufacturer. Q2: Can I get some sample? A2: Yes Q3: What's your MOQ? A3: Our MOQ is flexible.different price for different quantity Q4: Is there a discount? A4: Of course, welcome to contact us.

WEIFANG YANGXU GROUP Co., Ltd was founded in 1996. More than 20 years full efforts, YANGXU chemical has grown to be a large enzyme peptide chemical enterprise, specializing in expl

357952-10-4

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

Stresscopin (3-40) (mouse) CAS No.357952-10-4

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

Appearance:solid or liquid Storage:sealed in cool and dry place Package:As customer's requested Application:Pharma Intermediate Transportation:by courier/air/sea Port:Any port in China

Guangdong Juda Chemical Industrial Co.,Limited is a company specializing in APIs,pharmaceutical intermediates, electronic chemicals, plant extracts,fine chemicals and cosmetics raw

Urocortin III, mouse manufacturer

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers.Appearance:White powder Storage:keep sealed and keep from direct light Package:According customer's requirements Application:cosmetic pe

Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

more information,pls contact with us!

This information applies to the shipment of our products from Peptide Institute, Inc., Japan. Handling and shipping of orders placed with overseas sales agents may vary. LIABILITY

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

more information,pls contact with us!

Peptides International manufactures and distributes a wide variety of high purity, biologically active peptides and peptide-related products that are used in major research institu

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Min.Order: 0

FOB Price:  USD $ 0.0-0.0

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

As one of the top contract research organizations in the field of life science services, GenScript has created a one-stop, customizable service pac