86168-78-7 Sermorelin CAS NO.86168-78-7

sermorelin basic information
product name: sermorelin
synonyms: sermorelin;sermorelin acetate;yadaiftnsyrkvlgqlsarkllqdimsr-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2 human;h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;growth hormone releasing factor (1-29), amide, human;grf (1-29) amide (human)
cas: 86168-78-7
mf: c149h246n44o42s
mw: 3357.88
einecs:
product categories: amino acid derivatives;peptide;gh-rhobesity research;gh-rhpeptides for cell biology;growth hormone releasing factors;neuropeptides;neurotransmission (obesity);releasing factors
mol file: 86168-78-7.mol
sermorelin structure
sermorelin chemical properties
storage temp. −20°c
cas database reference 86168-78-7(cas database reference)
safety information
wgk germany 3
msds information
provider language
sigmaaldrich english
sermorelin usage and synthesis
usage xanthine oxidase inhibitor

our company was built in 2009 with an iso certificate.in the past 5 years, we have grown up as a famous fine chemicals supplier in china and we had established stable business relationships with samsung,lg,merck,thermo fisher scientific and so on.our main business covers the fields below:

1.noble metal catalysts (pt.pd...)

2.organic phosphine ligands (tert-butyl-phosphine.cyclohexyl-phosphine...)

3.oled intermediates (fluorene,carbazole,boric acid...)

4.customs synthesis

our advantage:

1. higest quality and good package

2.fast delivery

3.better payment term

4.fast response to customer within 6 hours

5.good business credit in europe ,us ,japan ,korea

anyway ,if you need any chemicals from china ,henan tianfu can help you