USD $10.00-10.00 / Gram
USD $10.00-10.00 / Gram
USD $10.00-10.00 / Gram
USD $8.20-8.80 / Kilogram
USD $10.00-10.00 / Gram
USD $1.00-10.00 / Kilogram
USD $9.00-99.00 / Kilogram
triumph has the complete production of g- kg - mt service chain,we can make the new technology into productivity quickly in the research and development of new products.
main service
1.own made fine chemical products
2.out sourcing and quality controlling service in china
3. com for chemical synthesis
4.lab custom synthesis of api and intermadiates
quality assurance
1. nmr,hplc and coa can be supplied
2. free sample for testing
recommend products
sodium dimethyl 5-sulphonatoisophthalate
cas:3965-55-7
calcitonin eel basic information |
product name: | calcitonin eel |
synonyms: | thyrocalcitonin eel;calcitonin, eel;csnlstcvlgklsqelhklqtyprtdvgagtp-nh2;csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7);h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 (disulfide bridge: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic |
cas: | 57014-02-5 |
mf: | c146h241n43o47s2 |
mw: | 3414.87 |
einecs: | 232-693-2 |
product categories: | tpi;peptide |
mol file: | 57014-02-5.mol |
calcitonin eel chemical properties |
storage temp. | −20°c |
safety information |
wgk germany |
3 |