Calcitonin eel CAS NO.57014-02-5

Min.Order Quantity:: 100 Metric Ton

Purity:: 98%min

Port:: Qingdao,China

Payment Terms:: L/C,T/T,MoneyGram,Other

Add to Inquiry Cart

Product Details

Keywords

57014-02-5
Calcitonin eel seller in China
Sell high quality 57014-02-5 produced in China factory

Quick Details

ProName: Calcitonin eel
CasNo: 57014-02-5
Molecular Formula: C146H241N43O47S2
Appearance: detailed see specifications
Application: Used for research and industrial manuf...
DeliveryTime: Within 3-7 days after receipt of your ...
PackAge: As customer request
Port: Qingdao,China
ProductionCapacity: 100 Metric Ton/Day
Purity: 98%min
Storage: Store in a cool,dry place and keep awa...
Transportation: Common products:Sea/Air/Courier Dange...
LimitNum: 100 Metric Ton

Superiority

triumph has the complete production of g- kg - mt service chain,we can make the new technology into productivity quickly in the research and development of new products.
main service
1.own made fine chemical products
2.out sourcing and quality controlling service in china
3. com for chemical synthesis
4.lab custom synthesis of api and intermadiates

quality assurance

1. nmr，hplc and coa can be supplied
2. free sample for testing

recommend products
sodium dimethyl 5-sulphonatoisophthalate
cas:3965-55-7

Details

calcitonin eel basic information

product name:	calcitonin eel
synonyms:	thyrocalcitonin eel;calcitonin, eel;csnlstcvlgklsqelhklqtyprtdvgagtp-nh2;csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7);h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 (disulfide bridge: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
cas:	57014-02-5
mf:	c146h241n43o47s2
mw:	3414.87
einecs:	232-693-2
product categories:	tpi;peptide
mol file:	57014-02-5.mol