1. iso 9001 approved, gmp producing standard,proffesional qa system, our quality is guaranteed.
2. facotory direct sale, most comptive price ensured;
3. audited supplier on lookchem, no trick, no scam!
4. enough stock can make sure safe delivery.
5. complete before and after sale service, welcome your questions and glad to help.
offer 86168-78-7
product information :
sermorelin basic information |
product name: | sermorelin |
synonyms: | sermorelin;sermorelin acetate;yadaiftnsyrkvlgqlsarkllqdimsr-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2 human;h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2;growth hormone releasing factor (1-29), amide, human;grf (1-29) amide (human) |
cas: | 86168-78-7 |
mf: | c149h246n44o42s |
mw: | 3357.88 |
einecs: | |
product categories: | amino acid derivatives;peptide;gh-rhobesity research;gh-rhpeptides for cell biology;growth hormone releasing factors;neuropeptides;neurotransmission (obesity);releasing factors |
mol file: | 86168-78-7.mol |
sermorelin chemical properties |
storage temp. | −20°c |
cas database reference | 86168-78-7(cas database reference) |
safety information |
wgk germany | 3 |
msds information |
provider | language |
---|---|
sigmaaldrich | english |
sermorelin usage and synthesis |
usage | xanthine oxidase inhibitor |
1. production capacity: we have three production base with high-tech production equipment and instruments, equipped with professional production personnel, meet your requirements.
2. quality assurance: we have a first-class testing equipment and testing personnel, in strict accordance with iso and cgmp standards, ensure that the quality of the shipment.
3.ultra-low prices, we follow the meager profit but high turnover principle to win more customers, to provide you with quality and cheap products.
4.the best service: we can real-time quotation, tracking service, ensure the safety of the goods to the clients.
5. customer groups: our clients throughout the world more than 30 countries, high quality products, low price, best service to win the customer's consistent high praise.
if you demand the product, you are welcome to contact us at any time, we guarantee that you seriously every inquiry, give you the fastest reply and the best service.