USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $10.00-10.00 / Gram
USD $9.00-99.00 / Kilogram
USD $10.00-10.00 / Gram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
USD $9.00-99.00 / Kilogram
our company was built in 2009 with an iso certificate.
in the past 5 years, we have grown up as a famous fine chemicals supplier in china and we had established stable business relationships with samsung,lg,merck,thermo fisher scientific and so on.
our main business covers the fields below:
1.noble metal catalysts (pt.pd...)
2.organic phosphine ligands (tert-butyl-phosphine.cyclohexyl-phosphine...)
3.oled intermediates (fluorene,carbazole,boric acid...)
4.customs synthesis
our advantage:
1.higest quality and good package
2.fast delivery
3.better payment term
4.fast response to customer within 6 hours
5.good business credit in europe ,us ,japan ,korea
glucagon-like peptide i fragment 7-36 amide human basic information
product name: glucagon-like peptide i fragment 7-36 amide human
synonyms: his-ala-glu-gly-thr-phe-thr-ser-asp-val-ser-ser-tyr-leu-glu-gly-gln-ala-ala-lys-glu-phe-ile-ala-trp-leu-val-lys-gly-arg-nh2;h-his-ala-glu-gly-thr-phe-thr-ser-asp-val-ser-ser-tyr-leu-glu-gly-gln-ala-ala-lys-glu-phe-ile-ala-trp-leu-val-lys-gly-arg-nh2;haegtftsdvssylegqaakefiawlvkgr-nh2;glp-1 [7-36];glp-1 (7-36) amide (human);glp-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;glp-1 (human, 7-36 amide) (bovine, canine, rat, guinea pig);glucagon-like peptide-1 [7-36]
cas: 107444-51-9
mf: c149h226n40o45
mw: 3297.63
einecs:
product categories: peptide;glucagon receptor and related
mol file: 107444-51-9.mol
glucagon-like peptide i fragment 7-36 amide human structure
glucagon-like peptide i fragment 7-36 amide human chemical properties
density 1.47
rtecs lz3980060
storage temp. −20°c
form powder
water solubility soluble in water (1 mg/ml).
inchikey dthnmhauyicors-ktkzvxajsa-n
safety information
wgk germany 3