Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 122384 > 

122384-88-7

Basic Information
CAS No.: 122384-88-7
Name: AMYLIN, HUMAN
Molecular Structure:
Molecular Structure of 122384-88-7 (AMYLIN, HUMAN)
Formula: C165H261N51O55S2
Molecular Weight: 3903.31
Synonyms: 1,2-Dithia-5,8,11,14,17-pentaazacycloeicosane,cyclic peptide deriv;AC 001;Amlintide;Amylin (human);Diabetes-associatedpeptide (human);Human IAPP;Human amylin;Human islet amyloid peptide;Amylin, Human, Amide;L-Tyrosinamide,L-lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-seryl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-,cyclic (2®7)-disulfide;Amlintide [USAN:INN];L-Lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-seryl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-L-tyrosinamide, cyclic (2-7)-disulfide;L-Tyrosinamide, L-lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-seryl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-, cyclic (2-7)-disulfide;
Solubility: dissolved in DMSO or DMF first and then dilute with water
PSA: 1808.07000
LogP: -5.38340
  • Display:default sort

    New supplier

  • Factory Price API 99% AMYLIN, HUMAN 122384-88-7 GMP Manufacturer

  • Casno:

    122384-88-7

    Factory Price API 99% AMYLIN, HUMAN 122384-88-7 GMP Manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.1-0.1

    1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

    Xi'an Xszo Chem Co. Ltd is a wholly-owned subsidiary of the SZO Chem Group. SZO Group is composed of Xi'an Xszo Chem Co. Ltd & Shaanxi SZO Tech Co., Ltd. SZO industry Group have mo

  •  Xi'an Xszo Chem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-029-88698540

    Address:No.16,Jingqin Rd. JingWei Industrial park,Shaanxi,China,710200

       Inquiry Now

  • Amlintide

  • Casno:

    122384-88-7

    Amlintide

    Min.Order: 5 Kiloliter

    FOB Price:  USD $ 1.2-5.0

    Our main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • 122384-88-7 AMYLIN, HUMAN

  • Casno:

    122384-88-7

    122384-88-7 AMYLIN, HUMAN

    Min.Order: 1 Gram

    FOB Price:  USD $ 8900.0-8900.0

    Product Name: AMYLIN, HUMAN Synonyms: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (DISULFIDE BRIDGE: 2-7);LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-HIS-SER-SER-ASN-ASN-PHE-GLY-ALA-ILE-LEU-SER-SER-THR-ASN-VAL-GLY

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Manufacturer supply CAS 122384-88-7 with best quality

  • Casno:

    122384-88-7

    Manufacturer supply CAS 122384-88-7 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • AMYLIN, HUMAN  CAS:122384-88-7

  • Casno:

    122384-88-7

    AMYLIN, HUMAN CAS:122384-88-7

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    AMYLIN, HUMAN CAS:122384-88-7 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high quality organic intermedi

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • Diabetes-associated peptide amide human

  • Casno:

    122384-88-7

    Diabetes-associated peptide amide human

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • Diabetes-associated peptide amide human

  • Casno:

    122384-88-7

    Diabetes-associated peptide amide human

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • Amylin,human

  • Casno:

    122384-88-7

    Amylin,human

    Min.Order: 10 Gram

    FOB Price:  USD $ 100.0-100.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,

    Zibo Dorne chemical technology co., LTD. is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additive

  •  Zibo Dorne chemical technology co. LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-18560316533

    Address:No. 416, 4th floor, zhongguancun science and technology city, no. 1, west 6th road, zhangdian district

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • 122384-88-7  CAS NO.122384-88-7

  • Casno:

    122384-88-7

    122384-88-7 CAS NO.122384-88-7

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 7.0-8.0

    1.Applied in food field.it can improve the immune system and prolong life. 2.Appliedin cosmetic field.it can improve the skin care. 3.Applied in pharmaceutical field.it can treat various dieases. 4.Our product quality assurance will make our customer

    KAISA GROUP INC.is the enterprise which is specialize in manfacturing and exporting avariety of Chemical in China. We have the strong economic base and comprehensive technology.We

  •  KAISA GROUP INC

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:15131197030

    Address:1312 17th Street Suite 1402 Denver CO 80202

       Inquiry Now

  • Amlintide

  • Casno:

    122384-88-7

    Amlintide

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High purity, high success rate, short cycle and moderate priceAppearance:White powder solid Storage:Negative 20 degrees Celsius Package:5mg, 10mg 100mg, 1gram Application:Applied to various scientific research

    Anhui Research Peptide Biotechnology Co., Ltd. (hereinafter referred to as Specialized Peptide Biology, Hangzhou All Peptide Biology Hefei Branch) was established in 2018. It is

  •  Research Peptide Biotechnology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+87-17342063383

    Address:Room 0196, Four-storey Creative Space, EC Building, Baohe Garden Commercial Building, Baohe District.

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Lower price, sample is available,SDS test documents are available,large stock in warehouseAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:Fine chemical intermediates, used as the main raw material for the synthe

    GIHI CHEMICALS CO.,LIMITED, its former company is a small manufacturer who is specialized in the production of ester products which are used in the daily chemicals ,cosmetic produc

  •  GIHI CHEMICALS CO.,LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-86217390

    Address:No.567 Dengcai Street,Sandun,Westlake District,Hangzhou310030,Zhejiang,China.

       Inquiry Now

  • Amylin,human amidated

  • Casno:

    122384-88-7

    Amylin,human amidated

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High-quality peptides at competitive prices.Appearance:Powder Storage:-20℃ Package:PP bags inside,outside aluminium foil bag Application:Intermediate,peptides Transportation:Express, sea, air, land. Port:Shanghai,China

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • Diabetes-associated peptide amide human

  • Casno:

    122384-88-7

    Diabetes-associated peptide amide human

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Ansciep Chemical is a professional enterprise manufacturing and distributing fine chemicals and speciality chemicals. We have been dedicated to heterocycle compounds and phenyl rings for tens of years. This is our mature product for export. Our quali

    Antimex Chemical Limied, was founded in 2001, we are specializing in manufacturing & researching of Active pharmaceutical Ingredients,Veterinary pharm APIs,cosmetic ingredients,and

  •  Antimex Chemical Limied

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-21-50563169

    Address:Room1027,No.Jinyu Road,Pudong

       Inquiry Now

  • Amylin, human amidated

  • Casno:

    122384-88-7

    Amylin, human amidated

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    good quality, competitive price, thoughtful after sale serviceAppearance:white powder Storage:Keep it in dry,shady and cool place Package:25kg,50kg,180kg,200kg,250kg,1000kg,customization Application:Pharma;Industry;Agricultural;chemical reaserch Tran

    Wuhan Circle Star Bio-medic Technology co.,Ltd is located in wuhan, the central city of China, the core of the Changjiang river economic belt and known as the "thoroughfare of nin

  •  Wuhan Circle Star Chem-medical Technology co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-13437180835

    Address:Experimental Building 311-15, Nuclear Magnetic Spectrometer Industry Base, No. 128 Guanggu 7th Road, Donghu New Technology Development Zone, Wuhan (Wuhan Area, Free Trade Zone)

       Inquiry Now

  • 122384-88-7

  • Casno:

    122384-88-7

    122384-88-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Supply top quality products with a reasonable price Application:api

    Changchun Artel Import and Export Trade Co., Ltd. is located in Changchun City, Jilin Province. It is a high-tech modern private enterprise specializing in the research, developme

  •  Changchun Artel lmport and Export trade company

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-0431-80543058

    Address:Dianshi Plazza,Chaoyang District

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    factory?direct?saleAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:healing drugs Transportation:By sea Port:Shanghai/tianjin

    Henan Kanbei Chemical Co., Ltd. is a modern high-tech chemical enterprise integrating R&D, production and sales. The company has strong technical strength, advanced equipment, stri

  •  Henan Kanbei Chemical Co.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-152-37804566

    Address:Evergrande Future City, intersection of Zhengkai Avenue and Sixteenth Street, Kaifeng Area, Henan Pilot Free Trade Zone

       Inquiry Now

  • Diabetes Associated Peptide Amide human

  • Casno:

    122384-88-7

    Diabetes Associated Peptide Amide human

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    good quality, competitive price, thoughtful after sale serviceAppearance:white powder Storage:Keep it in dry,shady and cool place Package:1mg Application:Pharma;Industry;Agricultural;chemical reaserch Transportation:by express or by sea Port:Any port

    Shanghai Yuanye Bio-Technology Co., Ltd. is a comprehensive enterprise of life science, specializing in the research, development and sales of biochemical reagents, analytical stan

  •  Shanghai Yuanye Bio-Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-21-61845781

    Address:Building 6, No. 465, Changta Road,Songjiang District,Shanghai,China

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    factory?direct?saleAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:healing drugs Transportation:By sea Port:Shanghai/tianjin

    Zhejiang Jiuzhou Chemical Co.,Ltd is a market-oriented and innovation-driven biopharmaceutical company. The company is focusing on the R&D, manufacturing and sales of pharmaceutica

  •  ZHEJIANG JIUZHOU CHEM CO.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 19334956669

    Address:Waisha Road,Jiaojiang

       Inquiry Now

  • Amylin, Human

  • Casno:

    122384-88-7

    Amylin, Human

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    Shanghai Apeptide Co.,Ltd is one of famous-peptide manufacturers in China. For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc... Our website address: www.apeptides.com/en/ We have amyloid peptides

    APeptide is one of the largest custom peptide producers in China (For 10years old), we can be proud to offer reliable, high quality, competitive price peptide services directly

  • Shanghai Apeptide Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-60871011

    Address:No. 80 Chuanshan Shuyuan Steet,Pudong,Shanghai

       Inquiry Now

  • Amylin, human, amidewith factory price

  • Casno:

    122384-88-7

    Amylin, human, amidewith factory price

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Wuhan Sun-shine Bio-technology Corporation Limited is specializing in the anticancer, antitumor,heart head blood-vessel,pharmaceutical intermediates,fine Chemicals production and customization. Company has strong ability of research and development

    Wuhan Sun-shine Bio-technology Corporation Limited (Shanghai Sun-shine Chemical Technology Corporation Limited) is a high-tech enterprise engaged inR&D and sales of related compoun

  • Wuhan Sun-shine Bio-technology Corporation Limited

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+862765522452

    Address:武汉市东湖高新区高新二路388号生物医药加速器16栋501

       Inquiry Now

  • Diabetes Associated Peptide Amide human manufacturer

  • Casno:

    122384-88-7

    Diabetes Associated Peptide Amide human manufacturer

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers. Our advantages:1, High quality with competitive price:1) Standard:BP/USP/EP/Enterprise standard2) All Purity≥99%3) We are manufacturer

    Shaanxi Mingqi Chemical Co., Ltd is committed to the development of import and export trade in the production, operation and plant extracts of pharmaceutical raw materials and inte

  • Shaanxi Mingqi Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8618092428356

    Address:Weiyang District

       Inquiry Now

  • Amylin,human

  • Casno:

    122384-88-7

    Amylin,human

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

    Watson International Ltd is the business department of FCAD Group. FCAD helps clients from different fields to develop their required fine chemicals or formulations. From pharmaceu

  • Watson International Ltd

    United Kingdom  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+44 (0)2036089360-31

    Address:Chanceryhouse,Chancery Lan

       Inquiry Now

  • 122384-88-7  CAS NO.122384-88-7

  • Casno:

    122384-88-7

    122384-88-7 CAS NO.122384-88-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Price, service, company and transport advantage: 1. Best service, place of origin China, high quality, and reasonable price. 2. It's customers' right to choose the package (EMS, DHL, FEDEX, UPS). 3. It's customers' right

    Changchun Haofei Import and Export Trade Co. , Ltd is located in Changchun, Changchun, Jilin Province. We are a modern high-tech private enterprise specializing in the R & D, Produ

  • Jilin haofei import and export trade Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8615643102578

    Address:303 Room, Guanghui Park, Huanghe Road, Kuancheng District

       Inquiry Now

  • Amylin, human amidated

  • Casno:

    122384-88-7

    Amylin, human amidated

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We have strong R&D center which can support and provide custom synthesis accordingly such as fine chemicals,biotechnique , pharmaceuticals etc.We can provide free sample for our clients to test anf verify the quality of our goods.LongyuChem holds str

    Shanghai Longyu biotech Co., Ltd. is a large-scale modern chemical production enterprise dedicated to the production, research and development and sales of chemical products. It co

  • shanghai Longyu biotechnology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15821988213

    Address:Dalian Rd 950th

       Inquiry Now

  • High Quality 98% CAS 122384-88-7 Amylin, Human Peptide Powder

  • Casno:

    122384-88-7

    High Quality 98% CAS 122384-88-7 Amylin, Human Peptide Powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 100.0-100.0

    Wuhan Senwayer century chemical Co..Ltd located in the predominant Wuhan City where is a traffic hinge of China, specialize in producing and developing pharmaceutical & its intermediates, Pesticide Intermediate, food additive, Plant extracts,and

    Wuhan senwayer century chemical Co.,Ltd located in the predominant WuHan City where is a traffic hinge of China,specilize in producing and developing pharmaceutical & its intermedi

  • Wuhan Senwayer Century Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+862759707018

    Address:武昌区松竹路与烟霞路交叉处

       Inquiry Now

  • AMYLIN, HUMAN

  • Casno:

    122384-88-7

    AMYLIN, HUMAN

    Min.Order: 5 Gram

    FOB Price:  USD $ 0.0-0.0

    Henan Wising Chem specializes in sourcing chemicals in China. We are associated with many trusted manufacturers each having different areas of expertise required for meeting the needs of our local as well as overseas buyers. We have access to custom

    Henan Wising Chem Co., Ltd is a national high-tech enterprise with a passion for selling and an emphasis on customer care. We are committed to providing quality chemical products t

  • Henan Wising Chem Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-371-56100691

    Address:Jinshui District

       Inquiry Now

  • Amylin, human amidated with approved quality

  • Casno:

    122384-88-7

    Amylin, human amidated with approved quality

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditides and natural extract etc. We are capable to supply you with any quanti

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  • Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • Amlintide

  • Casno:

    122384-88-7

    Amlintide

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the Amlintide, CAS:122384-88-7 with the most competitive price and the best quality. We c

    Finetech Industry Limited is a company in England,which specializing in developing, manufacturing and marketing fine organic compounds and intermediates for the fine chemical and p

  • Finetech Industry Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-87465837

    Address:wuhan

       Inquiry Now

  • Amylin, human amidated       manufacturer

  • Casno:

    122384-88-7

    Amylin, human amidated manufacturer

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    Our Advantages: 1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 2. Samples free trial: our company welcome samples to test our quality the

    Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

  • Hangzhou Peptidego Biotech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0571-87213919

    Address:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN

       Inquiry Now

  • 122384-88-7

  • Casno:

    122384-88-7

    122384-88-7

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • Amylin, human amidated

  • Casno:

    122384-88-7

    Amylin, human amidated

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Amylin, human amidatedAppearance:White Storage:keep in dry and cool condition Package:25kg or according to cutomer's demand Application:Chemical research/pharma intermediate Transportation:By Sea,by Air,By courier like DHL or Fedx. Port:Shanghai/Shen

    Nanjing Raymon Biotech Co., Ltd. is specialized in developing and marketing middle & high level pharmaceutical intermediates. We are supplying different categories of high-quality

  • Nanjing Raymon Biotech Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-025-52181296

    Address:Block B, No. 918, Shuanglong Avenue

       Inquiry Now

  • AMylin

  • Casno:

    122384-88-7

    AMylin

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Do best quality products, erect the morality model Application:please email us, thanks

    Wuxi Morality Chemical Co., Ltd is specialized in the development and manufacture of industrial additives, bulk chemical intermediates, pharmaceutical raw materials and pesticide

  • Wuxi Morality Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-510-83597286 17768505220

    Address:B/7F, 321th WuYun Rd, Wanda Plaza, Wuxi City, 214174, China

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 122384-88-7

Chemistry

The Molecular Structure of Diabetes-associated peptide amide human (CAS NO.122384-88-7):

Molecular Weight: 3903.31
Molecular Formula: C165H261N51O55S2 
Solubility: it can be dissolved in DMSO or DMF first and then dilute with water.
Storage: Store at -20°C.Keep container tightly closed. Store in a cool dry place.
Synonyms: Amlintide [USAN:INN] ; AC 001 ; Amlintide ; Amylin (human) ; Human islet amyloid peptide ; UNII-U3U3114NE1 ; L-Lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-seryl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-L-tyrosinamide, cyclic (2-7)-disulfide ; L-Tyrosinamide, L-lysyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparaginyl-L-phenylalanyl-L-leucyl-L-valyl-L-histidyl-L-seryl-L-seryl-L-asparaginyl-L-asparaginyl-L-phenylalanylglycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-seryl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-asparaginyl-L-threonyl-, cyclic (2-7)-disulfide .

Specification

 Diabetes-associated peptide amide human (CAS NO.122384-88-7) that is structurally related to calcitonin, is secreted from the B cells of the pancreas. It has anoretic effects in rats. Diabetes-associated peptide amide human (CAS NO.122384-88-7) may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin .