Welcome to LookChem.com Sign In|Join Free
  • or
Home > Products > 47931 > 

47931-85-1

Basic Information
CAS No.: 47931-85-1
Name: Calcitonin salmon
Molecular Structure:
Molecular Structure of 47931-85-1 (Calcitonin salmon)
Formula: C145H240N44O48S2
Molecular Weight: 3431.85
Synonyms: Calciben;Calcimar;Calsyn;Calsynar;Catonin;Karil;L-Prolinamide,L-cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-a-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparaginyl-L-threonylglycyl-L-serylglycyl-L-threonyl-,cyclic (1?;Miacalcic;Miacalcin;Miadenil;Prontocalcin;Rulicalcin;SMC 021 A/C;Salcatonin;SalmonThyrocalcitonin;Salmon calcitonin;Salmon calcitonin I;Salmoncalcitonin-(1-32);Salmotonin;Stalcin;Tonocalcin;salcitonin;Calcitonin, salmon;
EINECS: 256-342-8
Density:
Melting Point:
Boiling Point:
Flash Point:
Solubility: 0.05 M acetic acid: 1 mg/mL, clear, colorless
Appearance: powder
Hazard Symbols:
Risk Codes:
Safety: 22-24/25
Transport Information:
  • Display:default sort

    New supplier

  • Salmon Calcitonin Acetate factory supply

  • Casno:

    47931-85-1

    Salmon Calcitonin Acetate factory supply

    Min.Order: 20 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    Our advantages: 1, High quality with competitive price: 2, Fast and safe delivery 3.Excellent pre-sales and after-sales service 4. Well-trained and professional technologist and sales with rich experience in the field for 5-10 years Appearanc

    Hangzhou Clap Technology Co., Ltd is a leading manufacturer and supplier of API, Pharma intermediates, organic and inorganic compounds, rare earth, pesticide, raw drugs, fine chemi

  •  HANGZHOU CLAP TECHNOLOGY CO,.LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-1358-8875226

    Address:Room 4198,Floor 4,No.4,ShanXian Road XiaCheng District,HangZhou city,ZheJiang province,China

       Inquiry Now

  • Salmon Calcitonin

  • Casno:

    47931-85-1

    Salmon Calcitonin

    Min.Order: 1 Gram

    FOB Price:  USD $ 1000.0-1000.0/Gram

    Salmon Calcitonin, 98%+ purity provided by Go Top Peptide Biotech with the most competitive price and fast safe delivery. Our advantages: 1. Our technical team has more than ten years experience of peptide research and production, providing

    Hangzhou Go Top Peptide Biotech is a private, technology-based company, located in Hangzhou, China. We dedicate to provide full services to those worldwide pharmaceutical, cosmeti

  •  Hangzhou Go Top Peptide Biotech Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88211951

    Address:No.452, 6th Street, Hangzhou Eco.& Tech Development zone, 310018 Zhejiang, CN.

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Professional Calcitonin salmon manufacturer in China. high quality with GMP grade large scale with Competitive price Our products include: Generic bulk peptide APIs, Cosmetic peptide, custom peptides and veterinary peptides. A

    Shenzhen JYMed Technology Co., Ltd is a high-tech enterprise specializing in R&D, manufacture and commercialigation of peptides and related products including: the generic bulk pep

  •  Shenzhen JYMed Technology Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-755-26612112

    Address:RM1-105, Shenzhen Bio-incubator Base, 10 Gaoxin C Avc 1st, Nanshan District, Shenzhen, GD, China, 518057

       Inquiry Now

  • Calcitonin salmon Manufacturer/High quality/Best price/In stock

  • Casno:

    47931-85-1

    Calcitonin salmon Manufacturer/High quality/Best price/In stock

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-3.0/Kilogram

    DayangChem exported this product to many countries and regions at best price. If you are looking for the material's manufacturer or supplier in China, DayangChem is your best choice. Pls contact with us freely for getting detailed product spe

    Hangzhou Dayangchem Co.,Ltd dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(

  •  Hangzhou Dayangchem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • High quality Calcitonin salmon Cas 47931-85-1 with best price and good service

  • Casno:

    47931-85-1

    High quality Calcitonin salmon Cas 47931-85-1 with best price and good service

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Unique advantages of Calcitonin salmon Cas 47931-85-1 Guaranteed purity High quality & competitive price Quality control Fast feedback Prompt shipment Appearance:White powder Storage:Cool dry place Package:1g/foill bag A

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207852

    Address:A2705,Dong Yi Shi Qu,129# XinHua Road,WuHan,China

       Inquiry Now

  • High quality Salmon Calcitonin Acetate supplier in China

  • Casno:

    47931-85-1

    High quality Salmon Calcitonin Acetate supplier in China

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our c

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • Calcitonin (Salmon)

  • Casno:

    47931-85-1

    Calcitonin (Salmon)

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    1) High quality with competitive price: We are manufacturer and can provide high quality products with factory price. 2) Fast and safe delivery a) Parcels can be sent out within 1-7days after payment and tracking number is available.

    READLINE was established in 2013. The company is headquartered in the "National Science and Technology Business Incubator" in Shenzhen Nanshan Hi-tech Industrial Park. It is an inn

  •  Shenzhen READLINE Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-755-26659310

    Address:2-101,Bio-incubator, Gaoxin C.1st Ave., Shenzhen Hi-tech Industrial Park,ShenZhen,

       Inquiry Now

  • Calcitonin (salmon)

  • Casno:

    47931-85-1

    Calcitonin (salmon)

    Min.Order: 10 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    1.Professional synthesis laboratory and production base. 2.Strong synthesis team and service team. 3.Professional data management system. 4.We provide the professional test date and product information ,ex. HNMR ,CNMR,FNMR, HPLC/G

    Founded in 2011, Amadis Chemical Company Limited is an innovative manufacturer of chemical products and technical service providers. Our business includes sales, manufacture, and s

  •  Amadis Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-89925085

    Address:Watts Cosine.No.166.Xiangmao Road.

       Inquiry Now

  • Calcitonin (Salmon)

  • Casno:

    47931-85-1

    Calcitonin (Salmon)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Chemwill Asia co.,Ltd is one of the leading manufacturer in CHINA.Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Active pharmaceutical ingredients(APIs), Veterinary, Indole derivatives, Aro

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • calcitonin

  • Casno:

    47931-85-1

    calcitonin

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0/Milligram

    Apeptide Co.,Ltd (Shanghai ,China) is one of famous-peptide manufacturers in China. For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc... Our website address: www.apeptides.com/en/ We have amyloid

    APeptide is one of the largest custom peptide producers in China (For 10years old), we can be proud to offer reliable, high quality, competitive price peptide services directly

  •  Shanghai Apeptide Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-60871011

    Address:No. 80 Chuanshan Shuyuan Steet,Pudong,Shanghai

       Inquiry Now

  • Calcitonin Salmon Acetate High Quality Peptide Powder

  • Casno:

    47931-85-1

    Calcitonin Salmon Acetate High Quality Peptide Powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    The first listed company in peptides industry, mature process, stable and advaced technology,API capacity reaches to 500kg with 3 main factory sites. Appearance:white to off white Storage:2-8 degree Package:Aluminum Foil Bag Application:Salmon calc

    Hybio Pharmaceutical Co., Ltd., a hi-tech enterprise specialized in the R&D and manufacturing of diverse peptides, founded in 2003, is one of pioneers who are firstly dedicated in

  •  Hybio Pharmaceutica Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86 755 26588093

    Address:Hybio Medicine Park, No. 37, Keji C. Str 2nd Shenzhen Hi-tech Industrial Park 518057 P.R.China

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0/Kilogram

    Product name: Salmon Calcitonin Cas No.: 47931-85-1 Molecular formular: C145H240N44O48S2 Molecular weight : 3431.85 Purity: 99.0-101.0% Appearance:White crystalline Powder Appearance:White powder Storage:Store in cool and dry place, awa

    Welcome to Henan Sinotech! Sinotech Corporation has exceptional sourcing ability for chemicals used in Organic Fine Chemicals and APIs; Inorganic chemicals; Flame Retardants;OLED

  •  Henan Sinotech Import&Export Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-371-86181678

    Address:No. 260, Dongming Road,Jinshui District

       Inquiry Now

  • 47931-85-1         C145H240N44O48S2       Calcitonin salmon

  • Casno:

    47931-85-1

    47931-85-1 C145H240N44O48S2 Calcitonin salmon

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Calcitonin salmon Basic information Product Name: Calcitonin salmon Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCV

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371- 55366292

    Address:No.110 HONGZHUAN ROAD, ZHENGZHOU,HENAN

       Inquiry Now

  • 47931-85-1   Calcitonin salmon

  • Casno:

    47931-85-1

    47931-85-1 Calcitonin salmon

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1000.0-1000.0/Kilogram

    Our company was built in 2009 with an ISO certificate.In the past 6 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.O

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • 99% Calcitonin Salmon 47931-85-1 Lower Blood Calcium

  • Casno:

    47931-85-1

    99% Calcitonin Salmon 47931-85-1 Lower Blood Calcium

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Advantages: Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best s

    Hubei Xinrunde Chemical Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredient(s)

  •  Hubei XinRunde Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+8615102730682

    Address:No.43, Xinandu Industrial Park, East and West Lake District, Wuhan, Hubei, China

       Inquiry Now

  • bulk supply Calcitonin salmon

  • Casno:

    47931-85-1

    bulk supply Calcitonin salmon

    Min.Order: 5 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Calcitonin salmon Quick details Chemical Name: Calcitonin salmon CAS No.: 47931-85-1 Molecular Formula: C145H240N44O48S2 Molecular weight: 3431.85 Appearance: white powder Calcitonin salmon COA Delivery time:In sto

    Shaanxi Mingqi Chemical Co., Ltd is committed to the development of import and export trade in the production, operation and plant extracts of pharmaceutical raw materials and inte

  •  Shaanxi Mingqi Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18092428356

    Address:Weiyang District

       Inquiry Now

  • Good price peptide Salcitonin/Calcitonin salmon powder

  • Casno:

    47931-85-1

    Good price peptide Salcitonin/Calcitonin salmon powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 1000.0-1500.0/Gram

    Product advantage: --Good price --High quality --Well packed Service advantage: Pre-sale service 1. Technical consultancy, to help customer know about the properties, features, quality, production and supply of the product they want.

    Wuhan Vanz Pharm Inc. is a manufacturer&trading company.

  •  Wuhan Vanz Pharm Inc.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-27-84492310

    Address:FANHU INDUSTRY PARK

       Inquiry Now

  • High Quality Calcitonin Salmon

  • Casno:

    47931-85-1

    MSDS/COA Download

    High Quality Calcitonin Salmon

    Min.Order: 10 Gram

    FOB Price:  USD $ 20.0-20.0/Gram

    CAS No.: 47931-85-1 Other Names: Calcitonin MF: C145H240N44O48S2 EINECS No.: / Place of Origin: Hubei, China (Mainland) Type: Blood System Agents Gra

    HUBEI AOKS BIO-TECH CO.,LTD is located in Hubei province of China.We specialized in Active pharmaceutical ingredient,pharmaceutical intermediates,veterinary drug intermediates and

  •  HUBEI AOKS BIO-TECH CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-27-52345788

    Address:28F,China Construction Third Bureau,Wuhan,Hubei Province, China

       Inquiry Now

  • Fresh In Stock:Salcitonin with BEST PRICE

  • Casno:

    47931-85-1

    Fresh In Stock:Salcitonin with BEST PRICE

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0/Kilogram

    Scale Chemical Corporation is a professional chemicals supplier, exporting bulk chemical materials around the world, especially Europe and America, with good quality, competitive price, fastsupply and excellent service. Our Advantage (3P+6S+1C):

    Scale Chemical Corporation is a professional chemicals supplier, exporting bulk chemical materials (e.g. N-methylaniline(CAS:100-61-8), L-tryptophan(CAS:73-22-3), and Nicotinamide(

  •  Scale Chemical Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:0592-5106912

    Address:Torch High-Tech Zone,No.56~58 Torch Road, Xiamen China

       Inquiry Now

  • Calcitonin (salmon) 47931-85-1

  • Casno:

    47931-85-1

    Calcitonin (salmon) 47931-85-1

    Min.Order: 10 Gram

    FOB Price:  USD $ 1.0-2.0/Gram

    1,Best Quality: Our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other countries, and we have got very good feedback from our customers.so you can trust us. 2, Payment method: for e

    Hubei Jusheng Technology Co., Ltd., is a large group corporation which engaged in the R&D and manufacture of chemicals, Pharmaceuticals and intermediates. We have earned ourselves

  •  Hubei Jusheng Technology Co., Ltd.,

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-18871490254

    Address:High-tech Industrial Park,Tianmen city,Hubei province.

       Inquiry Now

  • Nice Quality 47931-85-1 Calcitonin salmon

  • Casno:

    47931-85-1

    MSDS/COA Download

    Nice Quality 47931-85-1 Calcitonin salmon

    Min.Order: 10 Gram

    FOB Price:  USD $ 1.0-3.0/Gram

    Our Service: 1. Best quality in your requirement 2. Competitive price in china market 3. Mature technical support 4. Professional logistic support 5 . Full experience of large numberscontainers loading in chinese sea port 6 .Fast

    Wuhan Monad Medicine Tech Co.,LTD is a research and development, production, sales in one high-tech company, own about 100 kinds of products, can provide about more than 30000 kind

  •  Wuhan Monad Medicine Tech Co.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8613397160123

    Address:13th Floor, Tower B, Century Plaza, Zhongnan Road, Wuchang District, Wuhan, China.

       Inquiry Now

  • Calcitonin salmon 47931-85-1 CAS NO.47931-85-1

  • Casno:

    47931-85-1

    Calcitonin salmon 47931-85-1 CAS NO.47931-85-1

    Min.Order: 100 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    we are a professional chemical raw materials manufacturer and exporter for many years. Company advantage: 1.Strict raw material selection 2.Mature production process 3.Perfect quality control system 4.Intimate servcie 5.Competitive pri

    We, Jilin Tely Imp & Exp Co., Ltd. mainly supply and export products including: pharmaceutical raw materials,Chemical reagents, Food additives, pharmaceutical and pesticide interme

  •  Jilin Tely Imp.& Exp.Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-431-81915458

    Address:Room 302, 47 Changping Street, Chaoyang District, Changchun, Jilin Province,China

       Inquiry Now

  • Calcitonin salmon  free sample available best quality

  • Casno:

    47931-85-1

    Calcitonin salmon free sample available best quality

    Min.Order: 100 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Product Name: Calcitonin salmon Synonyms: Salcitonin;Calcitonin Salmon (20 mg) (COLD SHIPMENT REQUIRED);Salcitonin Acetate(SalMon Calcitonin);Salcatonin, SalMon Calcitonin, Thyrocalcitonin (salMon);SalMon Calcitonin Aceta;H-CYS-SER-ASN-LEU-SER-T

    Wuhan Zenuo Biopharmaceutical Technology Co., Ltd. is a global biopharmaceutical and chemical enterprise, mainly engaged in the customized synthesis, large-scale production and sal

  •  Wuhan Zenuo Biological Medicine Technology Co Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:(+86-27)8700-2750

    Address:Floor 19th,No.76,Longyang Road

       Inquiry Now

  • Calcitonin (Salmon)

  • Casno:

    47931-85-1

    Calcitonin (Salmon)

    Min.Order: 1 Gram

    FOB Price:  USD $ 10.0-10.0/Gram

    Superiority: Zhejiang J&C Biological Technology Co., Limited is specialized in the production of high complex new type intermediates and chemical custom synthesis, scale-up production and rare chemicals trade. Products category is including I

    ZHEJIANG BIOLOGY AND TECHNOLOGY CO., LTD. is a modern professional high-tech enterprise, which is specializing in generic APIs and pharmaceutical intermediates. especially in pepti

  •  Zhejiang J&C Biological Technology Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15857007529

    Address:46# zhongshan road, quzhou zhejiang

       Inquiry Now

  • Hot selling of  Calcitonin salmon

  • Casno:

    47931-85-1

    MSDS/COA Download

    Hot selling of Calcitonin salmon

    Min.Order: 5 Gram

    FOB Price:  USD $ 1.0-1.0/Gram

    Product Name: Calcitonin salmon Synonyms: Salcitonin;Calcitonin Salmon (20 mg) (COLD SHIPMENT REQUIRED);Salcitonin Acetate(SalMon Calcitonin);Salcatonin,

    Henan CoreyChem Co., Ltd, based on the original Zhengzhou Cote Chemical Research Institute, be brave in absorbing highly educated talents & overseas returnees; actively responded t

  •  Career Henan Chemical Co

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-371-86658258

    Address:Building 3 of Innovation Park, East District of the National University Science Park

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Our Services 1. New Molecules R&D 2. Own test center HPLC NMR GC LC-MS 3. API and Intermediates from China reputed manufacturers 4. Documents support COA MOA MSDS DMF open part Our advantages 1. Government awarded company. Top 100 enter

    AFINE CHEMICALS LIMITED is specialized in the fine chemicals and pharmaceuticals and we have enjoyed great popularity in world markets. Since 2005, we have been rapidly growing to

  •  Afine Chemicals Limited

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-85134551

    Address:No. 206 Zhen Hua Road, Hangzhou 310030, Zhejiang, China

       Inquiry Now

  • supply 99% Salmon Calcitonin Acetate powder

  • Casno:

    47931-85-1

    supply 99% Salmon Calcitonin Acetate powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    1.high quality: quality is life. quality is the most important element for all goods. we have a lab doing research in wuhan china. hplc and nmr is available if needed. 2.reasonable price: we provide high quality products with competitive pric

    Wuhan WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of fine chemicals, APIs and pharmaceutical intermediates. WOND

  •  WUHAN WONDA PHARMACEUTICAL AND CHEMICAL LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18186124209

    Address:Wuhan Private Science and Technology Park , Wuhan, China

       Inquiry Now

  • Salmon Calcitonin Acetatewith factory price

  • Casno:

    47931-85-1

    Salmon Calcitonin Acetatewith factory price

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0/

    Wuhan Sun-shine Bio-technology Corporation Limited is specializing in the anticancer, antitumor,heart head blood-vessel,pharmaceutical intermediates,fine Chemicals production and customization. Company has strong ability of research and development

    Wuhan Sun-shine Bio-technology Corporation Limited (Shanghai Sun-shine Chemical Technology Corporation Limited) is a high-tech enterprise engaged inR&D and sales of related compoun

  •  Wuhan Sun-shine Bio-technology Corporation Limited

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-27-65522452

    Address:No. 388 Gaoxin Road(No. 2), East Lake Hi-tech Development Zone, Wuhan, Hubei Province, PRC

       Inquiry Now

  • Calcitonin cas 47931-85-1

  • Casno:

    47931-85-1

    Calcitonin cas 47931-85-1

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0/Kilogram

    Our advantages 1, High quality with competitive price 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can

    Henan Firsvict Industrial Co.,Ltd,build onn 2020,is not a new-born company.We have been in this area for more than 9 years and be able to offer reliable quality and after-sale serv

  •  Henan Firsvict Industrial Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371-61178988

    Address:河南省郑州市金水区南阳路38号太极公馆1号楼2单元405室

       Inquiry Now

  • Calcitonin salmon with approved quality

  • Casno:

    47931-85-1

    Calcitonin salmon with approved quality

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peditides and natural extract etc. We are capable to supply you with any quan

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  •  Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:13437110400

    Address:wuhan

       Inquiry Now

  • Calcitonin salmon,47931-85-1

  • Casno:

    47931-85-1

    Calcitonin salmon,47931-85-1

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    1. Quality: High purity, strict quality control, 10 years experience in chemical industry. 2. Price: Moderate price, more QTY more discount. 3. MOQ: Sample order is welcome to test quality. 4. Shipping time: In Stock, can be shipped in 2-3 da

    Wuhan MoonZY Biological Technology Co.,Ltd (MoonzyBio)is located in Wuhan city,hubei province,China,we have a group of senior technical backbones, specialized in R & D and sales in

  •  Wuhan MoonZY Biological Technology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:13545198479

    Address:203,Building 3, International Enterprise Center, No. 1 Guanshan 2nd Road, East Lake New Technology Development Zone,

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Changzhou Extraordinary Pharmatech co., LTD. As a leading chemical manufacturer and supplier in China.DAS authentication is passed.We can provide the popular precursor chemicals, we have our own strong R & D team, have our own laboratories and fa

    Changzhou Extraordinary Pharmatech co., LTD. Is a full technical team and for the development of hardware and software facilities manufacturing enterprises,The company is located i

  •  Changzhou Extraordinary Pharmatech co.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 519 82111935

    Address:Chinese Jiangsu Province Changzhou City Jintan District Jincheng Town Miaotou NO4(Pharmaceutical Park)

       Inquiry Now

  • Salcitonin

  • Casno:

    47931-85-1

    Salcitonin

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0/Gram

    Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0/Metric Ton

    Name Calcitonin salmon Synonyms Thyrocalcitonin Molecular Structure Molecular Formula C145

    Hangzhou Jinlan Pharm-Drugs Technology Co.,Ltd is located in Hangzhou, Zhejiang Province. Neighboring Ningbo port, Shanghai port, Hangzhou Xiaoshan Int’l Airport and Shanghai Pudon

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

Please post your buying leads,so that our qualified suppliers will soon contact you!
*Required Fields