Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 47931 > 

47931-85-1

Refine

Refine

Country

Business Type

Certificate

Display

Basic Information
CAS No.: 47931-85-1
Name: Calcitonin salmon
Molecular Structure:
Molecular Structure of 47931-85-1 (Calcitonin salmon)
Formula: C145H240N44O48S2
Molecular Weight: 3431.85
Synonyms: Calciben;Calcimar;Calsyn;Calsynar;Catonin;Karil;L-Prolinamide,L-cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-a-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparaginyl-L-threonylglycyl-L-serylglycyl-L-threonyl-,cyclic (1?;Miacalcic;Miacalcin;Miadenil;Prontocalcin;Rulicalcin;SMC 021 A/C;Salcatonin;SalmonThyrocalcitonin;Salmon calcitonin;Salmon calcitonin I;Salmoncalcitonin-(1-32);Salmotonin;Stalcin;Tonocalcin;salcitonin;Calcitonin, salmon;
EINECS: 256-342-8
Density: 1.54±0.1 g/cm3(Predicted)
Solubility: 0.05 M acetic acid: 1 mg/mL, clear, colorless
Appearance: powder
Safety: 22-24/25
PSA: 1558.81000
LogP: -3.89630
  • Display:default sort

    New supplier

  • Salmon Calcitonin

  • Casno:

    47931-85-1

    Salmon Calcitonin

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • Calcitonin Salmon 47931-85-1 Sufficient supply    high-quality     Manufactor

  • Casno:

    47931-85-1

    Calcitonin Salmon 47931-85-1 Sufficient supply high-quality Manufactor

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Product Name :Calcitonin Salmon CAS 47931-85-1 Appearance: White powder Molecular formula:C145H240N44O48S2 Molecular weight 3431.85 Packing Specification :1 g,10g,100g Appearance:White powder Application:Pharmaceutical industry Transpor

    Sichuan Jisheng Biopharmaceutical Co., Ltd.(JSJ), established in 2015, is located in the high-tech industrial zone of Leshan city, Sichuan province, covering an area of 60,000 squ

  •  Sichuan Jisheng BioPharmaceutical Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-833-2598983

    Address:No. 3, Jianye Road, High-tech Zone, Leshan City, Sichuan, China

       Inquiry Now

  • salmon calcitonin 47931-85-1 manufacturer/high quality/in stock

  • Casno:

    47931-85-1

    salmon calcitonin 47931-85-1 manufacturer/high quality/in stock

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    CHANGZHOU HANGYU PHARMACEUTICAL TECHNOLOGY CO., LTD. founded in 1984, engages in pharmaceutical research, development, production, process design and technical consultation of synthetic and fermentation pharmaceutical products. The organizational s

    CHANGZHOU HANGYU PHARMACEUTICAL TECHNOLOGY CO., LTD., founded in 1984, engages in pharmaceutical research, development, production, process design and technical consultation of syn

  •  CHANGZHOU HANGYU PHARMACEUTICAL TECHNOLOGY CO., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-519-88802789

    Address:No.300,Yanling Middle Road, Changzhou, Jiangsu, China

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Professional Calcitonin salmon manufacturer in China. high quality with GMP grade large scale with Competitive price Our products include: Generic bulk peptide APIs, Cosmetic peptide, custom peptides and veterinary peptides. A

    Shenzhen JYMed Technology Co., Ltd is a high-tech enterprise specializing in R&D, manufacture and commercialigation of peptides and related products including: the generic bulk pep

  •  Shenzhen JYMed Technology Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-755-26612112

    Address:RM1-105, Shenzhen Bio-incubator Base, 10 Gaoxin C Avc 1st, Nanshan District, Shenzhen, GD, China, 518057

       Inquiry Now

  • Calcitonin salmon Manufacturer/High quality/Best price/In stock

  • Casno:

    47931-85-1

    Calcitonin salmon Manufacturer/High quality/Best price/In stock

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-3.0

    DayangChem exported this product to many countries and regions at best price. If you are looking for the material's manufacturer or supplier in China, DayangChem is your best choice. Pls contact with us freely for getting detailed product spe

    Dayang Chem (Hangzhou) Co.,Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredi

  •  Dayang Chem (Hangzhou) Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • High quality Salmon Calcitonin Acetate supplier in China

  • Casno:

    47931-85-1

    High quality Salmon Calcitonin Acetate supplier in China

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • Good price peptide Salcitonin/Calcitonin salmon powder

  • Casno:

    47931-85-1

    Good price peptide Salcitonin/Calcitonin salmon powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 1000.0-1500.0

    Product advantage: --Good price --High quality --Well packed Service advantage: Pre-sale service 1. Technical consultancy, to help customer know about the properties, features, quality, production and supply of the product they want.

    Wuhan Vanz Pharm Inc. is a manufacturer&trading company.

  •  Hubei Vanz Pharm Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-27-84492310

    Address:FANHU INDUSTRY PARK

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Gram

    FOB Price:  USD $ 150.0-3500.0

    LIDE PHARMACEUTICALS LTD.was established in Apr.,2010. It is located in Jiangbei New District, Pukou District, Nanjing, which is the capital of total six dynasties in the Chinese history. We are a company that provides customized development and prod

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-25-58409506

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • Hot Sale high quality Calcitonin salmon Cas 47931-85-1with specialized manufacturer

  • Casno:

    47931-85-1

    Hot Sale high quality Calcitonin salmon Cas 47931-85-1with specialized manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 165.0-165.0

    Unique advantages for Calcitonin salmon Cas 47931-85-1 Guaranteed the purity High quality & competitive price Quality control Fast feedback Prompt shipment Appearance:Powder Storage:?20°C Package:1kg/foil bag, 25kg/drum or as you

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207852

    Address:Add: Room 2015, No.2 Building, Kaixin Mansion No.107 Jinqiao Avenue, Wuhan, China

       Inquiry Now

  • Factory Supply Salmon Calcitonin Acetate

  • Casno:

    47931-85-1

    Factory Supply Salmon Calcitonin Acetate

    Min.Order: 1

    FOB Price:  USD $ 0.0-0.0

    The above product is Ality Chemical's strong item with best price, good quality and fast supply. Ality Chemical has been focusing on the research and production of this field for over 14 years. At the same time, we are always committed to providi

    Ality Chemical, established in 2007, is a comprehensive Chemical Production&Supply Group with Patent Technology as its core. Ality Chemical operates sales branches in Shanghai, Xia

  •  Ality Chemical Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-(0)592-8883942

    Address:Fine chemical industry park, Nantong,Jiangsu

       Inquiry Now

  • Calcitonin (salmon)

  • Casno:

    47931-85-1

    Calcitonin (salmon)

    Min.Order: 10 Milligram

    FOB Price:  USD $ 0.0-0.0

    1.Professional synthesis laboratory and production base. 2.Strong synthesis team and service team. 3.Professional data management system. 4.We provide the professional test date and product information ,ex. HNMR ,CNMR,FNMR, HPLC/G

    Founded in 2011, Amadis Chemical Company Limited is an innovative manufacturer of chemical products and technical service providers. Our business includes sales, manufacture, and s

  •  Amadis Chemical Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-89925085

    Address:Watts Cosine.No.166.Xiangmao Road.

       Inquiry Now

  • lower price High quality Calcitonin salmon

  • Casno:

    47931-85-1

    lower price High quality Calcitonin salmon

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceu

    Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech bio chemical products enterprises. The company's

  •  Shanghai Seasonsgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86 156 1855 4368

    Address:No.12, Lane 356, Chengnan Road, Chuansha Town, Shanghai

       Inquiry Now

  • Calcitonin (Salmon)

  • Casno:

    47931-85-1

    Calcitonin (Salmon)

    Min.Order: 5 Kiloliter

    FOB Price:  USD $ 1.2-5.0

    Our main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • Salcitonin Acetate/ CAS:47931-85-1/ Raw material supply

  • Casno:

    47931-85-1

    Salcitonin Acetate/ CAS:47931-85-1/ Raw material supply

    Min.Order: 25 Kilogram

    FOB Price:  USD $ 1.0-2.0

    Name:Salcitonin Acetate English Name:Salcitonin Acetate English Alias:Calcitonin salmon salmoncalcitonini Thyrocalcitonin CAS No.47931-85-1 Molecular formula:C145H240N44O48S2 Molecular weight:3431.85 Packaging Specification: 25kg/drum high p

    Hubei DiBo chemical co., LTD Hubei DiBo Chemical Co., Ltd. was founded in 2009, is located in Hubei Province on both sides of the Yangtze River, one of the ancient cities of Chines

  •  Hubei DiBo chemical co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86 15871366807

    Address:No. 782 of wuchang district of wuhan city, hubei province

       Inquiry Now

  • Calcitonin salmon 47931-85-1

  • Casno:

    47931-85-1

    Calcitonin salmon 47931-85-1

    Min.Order: 1 Gram

    FOB Price:  USD $ 100.0-100.0

    Our main business covers the fields below: 1.Noble Metal Catalysts (Pt.Pd...) 2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...) 3.OLED intermediates (Fluorene,Carbazole,Boric acid...) 4.Pharmaceutical intermediates

    Since our establishment in 2008,we have been exporting to more than 50 countries in Middle East, Europe and America. The production line covers different kinds of painting, plastic

  •  HENAN NEW BLUE CHEMICAL CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Salmon Calcitonin Acetate CAS 47931-85-1

  • Casno:

    47931-85-1

    Salmon Calcitonin Acetate CAS 47931-85-1

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 6.0-10.0

    With our good experience, we offer detailed technical support and advice to assist customers. We communicate closely with customers to establish their quality requirements. Consistent Quality Our plant has strict quality control in each manufacturin

    Our company specializes in processing and selling chemical raw materials, chemical th Asia, Europe, America, Africa and other more than 20 countries and regions. ? Companies adheri

  •  Hebei Dangtong Biological Technology Co..LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-139-10575315

    Address:No.1722, Block C, Yangguang Xinzhuo Plaza, 256 Renmin West Road, Fuxing District, Handan City, Hebei Province

       Inquiry Now

  • New production CAS 47931-85-1 with best quality

  • Casno:

    47931-85-1

    New production CAS 47931-85-1 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Product name: Salmon Calcitonin Cas No.: 47931-85-1 Molecular formular: C145H240N44O48S2 Molecular weight : 3431.85 Purity: 99.0-101.0% Appearance:White crystalline Powder Appearance:White powder Storage:Store in cool and dry place, awa

    Welcome to Henan Sinotech! Sinotech Corporation has exceptional sourcing ability for chemicals used in Organic Fine Chemicals and APIs; Inorganic chemicals; Flame Retardants;OLED

  •  Henan Sinotech Import&Export Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-371-86181678

    Address:No. 260, Dongming Road,Jinshui District

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon The Biggest & Best & Cheapest supplier in China, Top one manufacturer in China

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Hangzhou Huarong Pharm Co., Ltd. established since 2009 , has been always focusing on supplying products and services to our clients in the field of small molecule drug. Huarong Pharm has built platforms for the research, development and manufac

    Hangzhou Huarong Pharm Co., Ltd. established since 2009 , has been always focusing on supplying products and services to our clients in the field of small molecule drug. Huarong

  •  Hangzhou Huarong Pharm Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-86758373

    Address:Room1101, Hakim International Building, Gongshu District, Hangzhou, Zhejiang Province, China.

       Inquiry Now

  • 47931-85-1         C145H240N44O48S2       Calcitonin salmon

  • Casno:

    47931-85-1

    47931-85-1 C145H240N44O48S2 Calcitonin salmon

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Calcitonin salmon Basic information Product Name: Calcitonin salmon Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCV

    Henan Sunlake Enterprise Corporation is located in Henan Province , the central plain of China , which enjoys favorable geogeaphical position and convenient transportion. The compa

  •  HENAN SUNLAKE ENTERPRISE CORPORATION

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-371- 86259723

    Address:Mingmen International Center, NO.222 Dongming Road,Zhengzhou,Henan,China

       Inquiry Now

  • Calcitonin Salmon Manufacturer CAS:47931-85-1

  • Casno:

    47931-85-1

    Calcitonin Salmon Manufacturer CAS:47931-85-1

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Advantages: Hubei XinRunde Chemical Co., Ltd is a renowned pharmaceutical manufacturer. We can offer high quality products at competitive price in quick delivery with 100% custom pass guaranteed. Never stop striving to offer our best s

    Hubei Langyou International Trading Co., Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical I

  •  Wuhan 90000 Lithium Industry and Trade Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-027-83214688

    Address:No.43, Xinandu Industrial Park, East and West Lake District, Wuhan, Hubei, China

       Inquiry Now

  • Calcitonin(salmon) cas 47931-85-1

  • Casno:

    47931-85-1

    Calcitonin(salmon) cas 47931-85-1

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Appearance:White or almost white powder Storage:R.T Package:1G/Bottle, 10G/Bottle, 50G/Bottle or at customers requirement. Application:treat osteoporosis Transportation:Express/Sea/Air Port:Any port in China

    Founded in 2005, Sartort, located in Hangzhou, is a leading company engaging in chemistry, pharmaceutical and advanced materials. At present, Sartort has such controlled subsidi

  •  Hangzhou Sartort Biopharma Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-87039693

    Address:No. 57, Tech Park Road, Hangzhou, Zhejiang, China

       Inquiry Now

  • High Quality API 99% Calcitonin salmon, CAS 47931-85-1 competitive Calcitonin salmon price

  • Casno:

    47931-85-1

    High Quality API 99% Calcitonin salmon, CAS 47931-85-1 competitive Calcitonin salmon price

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 110.0-130.0

    Hanways chempharm is a specialized company concentrating on the R&D, production, marketing and technical service of APIs and pharmaceutical intermediates. The marketing department is located in Wuhan. We have two GMP facilities in Hubei Pr

    Hubei Hanways Pharmchem Co.,Limited is a specialized company concentrating on the R&D, production, marketing and technical service of APIs and pharmaceutical intermediates. Now we

  •  HANWAYS CHEMPHARM CO.,LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-18502787239(whatsapp)

    Address:18-1-802, Green Garden, Jianghan District, Wuhan 430023, China

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Milligram

    FOB Price:  USD $ 5.0-5.0

    Our company has been in existence for 10 years since its establishment. We have our own unique team. The company integrates independent research and development, production and sales. We have established famous brands at home and abroad. At present,

    Baoji Guokang Healthchem co.,ltd located in Baoji High-tech Zone,is epitomizing international,cooperative and honest.We are a young company full of action and energy,and our profes

  •  Baoji Guokang Healthchem co.,ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-917-3909592

    Address:China

       Inquiry Now

  • High Quality Calcitonin Salmon Manufacturers

  • Casno:

    47931-85-1

    High Quality Calcitonin Salmon Manufacturers

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Beluga chemical professional supply High Quality Calcitonin Salmon Manufacturers 1. Beluga Chemical has a professional RESEARCH and development team and strong technical force to ensure technical support and research capabilities. 2. Made in Chin

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • Salmon Calcitonin Acetate    manufacturer with low price

  • Casno:

    47931-85-1

    Salmon Calcitonin Acetate manufacturer with low price

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    We can provide GMP validation service that complies with SFDA, FDA, WHO and EU EMPA.Excellent registration team could help us easlily to register our products in different countries.If you and your customer are interested in some products or need CMO

    Hangzhou Jinlan Pharm-Drugs Technology Co., Ltd. (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Pro

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-133-29937817

    Address:Rm A606, Fuyi Center, jianqiao street

       Inquiry Now

  • supply 99% Salmon Calcitonin Acetate powder

  • Casno:

    47931-85-1

    supply 99% Salmon Calcitonin Acetate powder

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    1.high quality: quality is life. quality is the most important element for all goods. we have a lab doing research in wuhan china. hplc and nmr is available if needed. 2.reasonable price: we provide high quality products with competitive pric

    WUHAN WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of nootropics, herbal extract, OLED etc. Wuhan Wonda Pharm & Ch

  •  Wuhan Wonda Pharm Limited

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:027-84306245

    Address:Wuhan Private Science and Technology Park , Wuhan, China

       Inquiry Now

  • Pramlintide

  • Casno:

    47931-85-1

    Pramlintide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Pramlintide CAS: 47931-85-1 Specification Items Specification Result Assay 90.0%-105.0% 98.5% Peptide purity ≥95.0% 99

    Lonwin industry group limited.is a comprehensive chemical enterprise which mainly integrates development, production, marketing ,import and export business. The company is located

  •  Lonwin Chemical Group Limited

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:Tel: 86-21-59858395

    Address:No#966,Huaxu Road,Shanghai 201702,P.R.China

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Good Quality Calcitonin Salmon CAS 47931-85-1

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-12.0

    Hubei Yuanmeng Biological Technology Co., Ltd., which is located in Wuhan, China. We are specializing in the exportation of APIs, and plant extracts ect. Our products has been exported to America, Australia, Brazil, the Europe, Middle East and other

    Hubei Yuanmeng Biological Technology Co., Ltd., which is located in Wuhan, China. We are specializing in the exportation of APIs, and plant extracts ect. Our products has been exp

  •  Hubei Yuanmeng Biological Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-027-68897569

    Address:Hongshan District

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Our service: 1.We have experience in exporting Pharmaceutical intermediates . 2.Professional packing with professional materials 3. We have products in stock, and we will deliver them soon when your PO arrived. Meanwhile we will give you the trackin

    Hubei Mawer Biological Technology Co., Ltd is a leading manufacturer and supplier of API,Steroids,Peptide,HGH, Pharma intermediates, organic and inorganic compounds, rare earth, pe

  •  Hubei Mawer Biological Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86-18671111078

    Address:Wuhan port international Electromechanical City, development avenue, Ezhou City, Hubei Province

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, Dear friend! I'm Hanson from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by email in time. produc

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • Calcitonin salmon

  • Casno:

    47931-85-1

    Calcitonin salmon

    Min.Order: 100 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Our Services 1. New Molecules R&D 2. Own test center HPLC NMR GC LC-MS 3. API and Intermediates from China reputed manufacturers 4. Documents support COA MOA MSDS DMF open part Our advantages 1. Government awarded company. Top 100 enter

    AFINE CHEMICALS LIMITED is specialized in the fine chemicals and pharmaceuticals and we have enjoyed great popularity in world markets. Since 2005, we have been rapidly growing to

  •  Afine Chemicals Limited

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-85134551

    Address:No. 206 Zhen Hua Road, Hangzhou 310030, Zhejiang, China

       Inquiry Now

  • Salmon Calcitonin

  • Casno:

    47931-85-1

    Salmon Calcitonin

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Our product has a very high quality and now we are exporting to customers overseas with very positive feedback. With best price, quality and service from Nanjing Sunny, we are confident to set up a very nice cooperation with customers all over the w

    Welcome to Sunny Pharmatech! Nanjing Sunny pharmatech Co., Ltd is a manufacturer and supplier of raw materials and ingredients for food and healthy supplement products, intermediat

  •  NANJING SUNNY PHARMATECH CO., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-13814179829

    Address:No. 1704 SHUANGLONOG AVENUE, NANJING, CHINA

       Inquiry Now

  • Salcitonin

  • Casno:

    47931-85-1

    Salcitonin

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206/2850606

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • Calcitonin Salmon

  • Casno:

    47931-85-1

    Calcitonin Salmon

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det

    Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service profession

  •  Hangzhou Keyingchem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-85378921

    Address:Jintong international Building, No.113,Huayuangang Street, Gong shu District, Hangzhou,Zhejiang, China.

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1 Customer Service

What can I do for you?
Get Best Price

Get Best Price for 47931-85-1

Chemistry

Molecule structure of Calcitonin (salmon) (CAS NO.47931-85-1):

Molecular Weight: 3431.8531 g/mol
Molecular Formula: C145H240N44O48S2 
Storage Temp.: −20 °C
Solubility: 0.05 M acetic acid: 1 mg/mL, clear, colorless
Form: powder
XLogP3-AA: -16.6
H-Bond Donor: 52
H-Bond Acceptor: 55
Rotatable Bond Count: 99
Tautomer Count: 1001
Exact Mass: 3430.716662
MonoIsotopic Mass: 3429.713307
Topological Polar Surface Area: 1510
Heavy Atom Count: 239 
EINECS: 256-342-8
Product Categories of Calcitonin (salmon) (CAS NO.47931-85-1): Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor

Toxicity Data With Reference

Organism Test Type Route Reported Dose (Normalized Dose) Effect Source
dog LD50 intramuscular > 1600iu/kg (1600iu/kg) BEHAVIORAL: FOOD INTAKE (ANIMAL)

GASTROINTESTINAL: NAUSEA OR VOMITING
Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
monkey LD50 intravenous > 320iu/kg (320iu/kg)   Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
mouse LD50 intramuscular > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 intravenous > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 oral > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 subcutaneous > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
rabbit LD50 intramuscular > 500iu/kg (500iu/kg)   Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
rat LD50 intramuscular > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 intravenous > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 oral > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 subcutaneous > 72800ug/kg (72.8mg/kg)   Drugs in Japan Vol. -, Pg. 273, 1990.

Safety Profile

Safety Statements: 22-24/25 
S22:Do not breathe dust. 
S24/25:Avoid contact with skin and eyes.
WGK Germany: 3
RTECS: EV8000000
F: 3-10

Specification

 Calcitonin (salmon) (CAS NO.47931-85-1) is also named as Astronin ; Biocalcin ; Bionocalcin ; Cadens ; Calciben ; Calcihexal ; Calcimar ; Calcimonta ; Calcinil ; Calcioton ; Calcitonin ; Calcitonin salmon ; Calcitonin vom lachs ; Calcitonin, salmar ; Calcitonin, salmon, for bioassay ; Calcitonin,salmon ; Calcitonin-salmon ; Calcitonina ; Calcitonine de saumon ; Calcitoran ; Calco ; Calogen ; Calsynar ; Calsynar Lyo L ; Caltine ; Casalm ; Catonin ; Cibacalcin ; Cibacalcine ; Citonina ;
Eptacalcin ; Ipocalcin ; Isi-calcin ; Kalsimin ; Karil ; Miacalcin ; Miracalcic ; Oseototal ; Salcat ; Salcatonin ; Salcatyn ; Salmocalcin ; Salmofar ; Salmon calcitonin ; Salmon calcitonin I ; Salmon calcitonin-(I-32) ; Sical ; Stalcin ; Staporos ; Steocin ; TZ-CT ; Thyrocalcitonin (salmon) ; Tonocalcin ; UNII-7SFC6U2VI5 ; Ucecal .