Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 81306 > 

81306-64-1

Basic Information
CAS No.: 81306-64-1
Name: PTH (13-34) (HUMAN)
Molecular Structure:
Molecular Structure of 81306-64-1 (PTH (13-34) (HUMAN))
Formula: C125H199N39O33S
Molecular Weight: 2808.22
Synonyms: ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;
PSA: 1236.13000
LogP: 6.30010
  • Display:default sort

    New supplier

  • PTH (13-34) (HUMAN)

  • Casno:

    81306-64-1

    PTH (13-34) (HUMAN)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • PTH (13-34) (HUMAN)

  • Casno:

    81306-64-1

    PTH (13-34) (HUMAN)

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • pTH(13-34)(human)

  • Casno:

    81306-64-1

    pTH(13-34)(human)

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

  •  Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:xiameng

       Inquiry Now

  • PTH (13-34) (HUMAN)

  • Casno:

    81306-64-1

    PTH (13-34) (HUMAN)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • 81306-64-1

  • Casno:

    81306-64-1

    81306-64-1

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • PTH (13-34) (HUMAN)

  • Casno:

    81306-64-1

    PTH (13-34) (HUMAN)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High purity, high success rate, short cycle and moderate priceAppearance:White powder solid Storage:Negative 20 degrees Celsius Package:5mg, 10mg 100mg, 1gram Application:Applied to various scientific research

    Anhui Research Peptide Biotechnology Co., Ltd. (hereinafter referred to as Specialized Peptide Biology, Hangzhou All Peptide Biology Hefei Branch) was established in 2018. It is

  •  Research Peptide Biotechnology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+87-17342063383

    Address:Room 0196, Four-storey Creative Space, EC Building, Baohe Garden Commercial Building, Baohe District.

       Inquiry Now

  • 81306-64-1

  • Casno:

    81306-64-1

    81306-64-1

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Good Quality Package:1kg/bag Application:Medical or chemical Transportation:Air/Train/Sea Port:Shenzhen

    Shanghai Chinqesen Biotechnology Co., Ltd. Company slogan:Innovation, cooperation and win-win Company introduction:Shanghai Chinqesen Biotechnology Co., Ltd. is a professional phar

  •  Shanghai Chinqesen Biotechnology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8617316470195

    Address:333 Songze Avenue, Qingpu District, Shanghai

       Inquiry Now

  • PTH (13-34) (HUMAN)

  • Casno:

    81306-64-1

    PTH (13-34) (HUMAN)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    factory?direct?saleAppearance:White powder Storage:Sealed and preserved Package:200/Kilograms Application:healing drugs Transportation:By sea Port:Shanghai/tianjin

    Zhejiang Jiuzhou Chemical Co.,Ltd is a market-oriented and innovation-driven biopharmaceutical company. The company is focusing on the R&D, manufacturing and sales of pharmaceutica

  •  ZHEJIANG JIUZHOU CHEM CO.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 19334956669

    Address:Waisha Road,Jiaojiang

       Inquiry Now

  • pTH(13-34)(human)

  • Casno:

    81306-64-1

    pTH(13-34)(human)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

    Watson International Ltd is the business department of FCAD Group. FCAD helps clients from different fields to develop their required fine chemicals or formulations. From pharmaceu

  • Watson International Ltd

    United Kingdom  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+44 (0)2036089360-31

    Address:Chanceryhouse,Chancery Lan

       Inquiry Now

  • pTH (13-34) (human)

  • Casno:

    81306-64-1

    pTH (13-34) (human)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates, polypeptide, and natural extract etc。We are capable to supply you with any quantity of the mentioned products with

    Wuhan Prominence Bio-technology Co., Ltd is a leading provider and manufacturer of pharmaceutical and chemical products. Mainly involves API, pharmaceutical intermediates peptides

  • Wuhan Prominence Bio-technology Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18327075275

    Address:wuhan

       Inquiry Now

  • 81306-64-1

  • Casno:

    81306-64-1

    81306-64-1

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • Total:13 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 81306-64-1