Welcome to LookChem.com Sign In|Join Free
  • or
HENAN SUNLAKE ENTERPRISE CORPORATION47931-85-1 C145H240N44O48S2 Calcitonin salmon//www.lookchem.com/300w/2010/0621/47931-85-1.jpg
qq

Communicate with Supplier:

Ms. summer
Ms. summer: What can I do for you?

47931-85-1 C145H240N44O48S2 Calcitonin salmon CAS NO.47931-85-1

Min.Order Quantity:
10 Gram
Purity:
99%
Port:
Tianjin Shanghai
Payment Terms:
L/C,D/A,D/P,T/T,Other

Add to Inquiry Cart

Product Details

Keywords

  • 47931-85-1 C145H240N44O48S2 Calcitonin salmon
  • 47931-85-1
  • C145H240N44O48S2

Quick Details

  • ProName: 47931-85-1 C145H240N44O48S2 ...
  • CasNo: 47931-85-1
  • Molecular Formula: C145H240N44O48S2
  • Appearance: white powder
  • Application: Osteoporosis;Hypercalcemia; Paget’s di...
  • DeliveryTime: 5-7 days after payment
  • PackAge: Woven bag
  • Port: Tianjin Shanghai
  • ProductionCapacity: 1 Kilogram/Day
  • Purity: 99%
  • Storage: Normal temperature
  • Transportation: Ocean shipping Express delivery
  • LimitNum: 10 Gram

Superiority

calcitonin salmon basic information
product name: calcitonin salmon
synonyms: calcitonin, salmon;calcitonin (salmon i);csnlstcvlgklsqelhklqtyprtntgsgtp-nh2;csnlstcvlgklsqelhklqtyprtntgsgtp-nh2 (disulfide bridge: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2;cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2 salmon;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2 (disulfide bridge: 1-7)
cas: 47931-85-1
mf: c145h240n44o48s2
mw: 3431.85
einecs: 256-342-8
product categories: amino acid derivatives;peptide;calcitonin and cgrp receptor
mol file: 47931-85-1.mol
calcitonin salmon structure
calcitonin salmon chemical properties
storage temp. −20°c
solubility 0.05 m acetic acid: 1 mg/ml, clear, colorless
form powder
merck 13,1642
cas database reference 47931-85-1(cas database reference)
safety information
safety statements 22-24/25
wgk germany 3
rtecs ev8000000
f 3-10
msds information
provider language
sigmaaldrich english
calcitonin salmon usage and synthesis
usage osteoporosis;hypercalcemia; paget’s disease ; reflex sympathetic dystrophy (algodistrophy or sudeck’s disease)
calcitonin salmon preparation products and raw materials

Details

calcitonin salmon basic information
product name: calcitonin salmon
synonyms: calcitonin, salmon;calcitonin (salmon i);csnlstcvlgklsqelhklqtyprtntgsgtp-nh2;csnlstcvlgklsqelhklqtyprtntgsgtp-nh2 (disulfide bridge: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2;cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2 salmon;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2;h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asn-thr-gly-ser-gly-thr-pro-nh2 (disulfide bridge: 1-7)
cas: 47931-85-1
mf: c145h240n44o48s2
mw: 3431.85
einecs: 256-342-8
product categories: amino acid derivatives;peptide;calcitonin and cgrp receptor
mol file: 47931-85-1.mol
calcitonin salmon structure
calcitonin salmon chemical properties
storage temp. −20°c
solubility 0.05 m acetic acid: 1 mg/ml, clear, colorless
form powder
merck 13,1642
cas database reference 47931-85-1(cas database reference)
safety information
safety statements 22-24/25
wgk germany 3
rtecs ev8000000
f 3-10
msds information
provider language
sigmaaldrich english
calcitonin salmon usage and synthesis
usage osteoporosis;hypercalcemia; paget’s disease ; reflex sympathetic dystrophy (algodistrophy or sudeck’s disease)
calcitonin salmon preparation products and raw materials
hennan sunlake enterprise corporation is located in henan province , the central plain of china , which enjoys favorable geogeaphical position and convenient transportion, the com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .
sunlake is a professional manufacturer engaged in producing and selling chemicals,including organic & inorganic chemicals , pigments & dyestuffs , water treatment chemicals , food & feed additives and others . these products have been being well exported to europe , southeast asia , the middle east , africa , south america and some other countries and areas.
we sincerely welcome foreign friends to visit our plant for cooperation. with the idea of "quality first,credit priority, excellent service", we are highly acknowledged by customers for good quality and competitive price. more importantly , the company has a strong r & d team, who are professional engineers and scholars with ph. d. .so we are confident to serve you better with our high - quality products and professional team.
we are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market. we welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate with you for a brilliant future!
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)